Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Rat
    • Sequence
      MERSPAVCCQDPRAELVERVAAISVAHLEEAEEGPEPASNGVDPPPRARA ASVIPGSASRPTPVRPSLSARKFSLQERPAGSCLEAQVGPYSTGPASHMS PRAWRRPTIESHHVAISDTEDCVQLNQYKLQSEIGKGAYGVVRLAYNERE DRHYAMKVLSKKKLLKQYGFPRRPPPRGSQAPQGGPAKQLLPLERVYQEI AILKKLDHVNVVKLIEVLDDPAEDNLYLVFDLLRKGPVMEVPCDKPFPEE QARLYLRDIILGLEYLHCQKIVHRDIKPSNLLLGDDGHVKIADFGVSNQF EGNDAQLSSTAGTPAFMAPEAISDTGQSFSGKALDVWATGVTLYCFVYGK CPFIDEYILALHRKIKNEAVVFPEEPEVSEELKDLILKMLDKNPETRIGV SDIKLHPWVTKHGEEPLPSEEEHCSVVEVTEEEVKNSVKLIPSWTTVILV KSMLRKRSFGNPFEPQARREERSMSAPGNLLLKEGCGEGGKSPELPGVQE DEAAS
    • Molecular weight
      88 kDa including tags
    • Amino acids
      1 to 505
    • Tags
      proprietary tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab177255 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    9 nmol/min/mg

  • Applications

    Western blot

    SDS-PAGE

    Functional Studies

  • Purity
    > 85 % Densitometry.

  • Form
    Liquid
  • Additional notes

    ab64311 (Myelin Basic Protein protein) can be utilized as a substrate for assessing kinase activity

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • Ca2+/calmodulin-dependent protein kinase kinase alpha
    • Calcium/calmodulin dependent protein kinase kinase
    • Calcium/calmodulin dependent protein kinase kinase 1
    • Calcium/calmodulin dependent protein kinase kinase 1 alpha
    • Calcium/calmodulin dependent protein kinase kinase alpha
    • Calcium/calmodulin-dependent protein kinase kinase 1
    • Calcium/calmodulin-dependent protein kinase kinase alpha
    • CaM kinase kinase alpha
    • CaM-kinase IV kinase
    • CaM-kinase kinase 1
    • CaM-kinase kinase alpha
    • CaM-KK 1
    • CaM-KK alpha
    • CaMKK
    • CaMKK 1
    • CaMKK alpha
    • CAMKK alpha protein
    • Camkk1
    • CAMKKA
    • DKFZp761M0423
    • KKCC1_HUMAN
    • MGC34095
    • OTTMUSP00000006419
    see all
  • Function
    Calcium/calmodulin-dependent protein kinase that belongs to a proposed calcium-triggered signaling cascade involved in a number of cellular processes. Phosphorylates CAMK1, CAMK1D, CAMK1G and CAMK4. Involved in regulating cell apoptosis. Promotes cell survival by phosphorylating AKT1/PKB that inhibits pro-apoptotic BAD/Bcl2-antagonist of cell death.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
    Contains 1 protein kinase domain.
  • Domain
    The autoinhibitory domain overlaps with the calmodulin binding region and may be involved in intrasteric autoinhibition.
    The RP domain (arginine/proline-rich) is involved in the recognition of CAMKI and CAMK4 as substrates.
  • Post-translational
    modifications
    Appears to be autophosphorylated in a Ca(2+)/calmodulin-dependent manner. Phosphorylated at multiple sites by PRCAKA/PKA. Phosphorylation of Ser-458 is blocked upon binding to Ca(2+)/calmodulin. In vitro, phosphorylated by CAMK1 and CAMK4.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • The specific activity of ab177255 was determined to be 9 nmol/min/mg.

  • SDS-PAGE analysis of ab177255.

References

ab177255 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177255.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up