Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Rat
    • Sequence

      VPDSIDYRKKGYVTPVKNQGQCGSCWAFSSAGALEGQLKKKTGKLLALSP QNLVDCVSENYGCGGGYMTTAFQYVQQNGGIDSEDAYPYVGQDESCMYNA TAKAAKCRGYREIPVGNEKALKRAVARVGPVSVSIDASLTSFQFYSRGVY YDENCDRDNVNHAVLVVGYGTQKGNKYWIIKNSWGESWGNKGYVLLARNK NNACGITNLASFPKM
    • Molecular weight

      28 kDa including tags
    • Amino acids

      115 to 329
    • Tags

      His tag N-Terminus
    • Additional sequence information

      N-terminal 6xHis-tagged. Full length mature chain without signal peptide and without propeptide.

Specifications

Our Abpromise guarantee covers the use of ab235712 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • Cathepsin K
    • Cathepsin O
    • Cathepsin O1
    • Cathepsin O2
    • Cathepsin X
    • CATK_HUMAN
    • CTS02
    • Ctsk
    • CTSO
    • CTSO1
    • CTSO2
    • MGC23107
    • PKND
    • PYCD
    see all
  • Function

    Closely involved in osteoclastic bone resorption and may participate partially in the disorder of bone remodeling. Displays potent endoprotease activity against fibrinogen at acid pH. May play an important role in extracellular matrix degradation.
  • Tissue specificity

    Predominantly expressed in osteclasts (bones).
  • Involvement in disease

    Defects in CTSK are the cause of pycnodysostosis (PKND) [MIM:265800]. PKND is an autosomal recessive osteochondrodysplasia characterized by osteosclerosis and short stature.
  • Sequence similarities

    Belongs to the peptidase C1 family.
  • Cellular localization

    Lysosome.
  • Information by UniProt

Images

  • (Tris-glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel of ab235712.

References

ab235712 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235712.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up