Recombinant rat CD47 protein (Fc Chimera Active) (ab220571)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Tags: Fc tag C-Terminus
- Suitable for: SDS-PAGE, ELISA
Description
-
Product name
Recombinant rat CD47 protein (Fc Chimera Active)
See all CD47 proteins and peptides -
Biological activity
Immobilized Mouse SIRP alpha, Mouse IgG2a Fc Tag at 10 μg/mL (100 μL/well) can bind Rat CD47, Fc Tag (ab220571) with a linear range of 2-20 ng/mL.
-
Purity
> 95 % SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Rat -
Sequence
QLLLSKVKSVEFTSCNDTVVIPCKVLNVEAQSTDEMFVKWKLNKSYIFIY DGNKNSTTREQNFTSAKISVSDLLKGIASLTMDTHEAVVGNYTCEVTELS REGKTVIELKNRPVSWFSTNEK -
Predicted molecular weight
40 kDa -
Amino acids
19 to 140 -
Tags
Fc tag C-Terminus -
Additional sequence information
This protein carries a human IgG1 Fc tag at the C-terminus.
-
Specifications
Our Abpromise guarantee covers the use of ab220571 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
ELISA
-
Form
Lyophilized -
Additional notes
This product is stable after storage at:
- -20°C to -70°C for 12 months in lyophilized state;
- -70°C for 3 months under sterile conditions after reconstitution.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Please see notes section.
pH: 7.4
Constituents: 0.61% Tris, 0.75% Glycine, 5% Trehalose, 0.44% L-Arginine, 0.87% Sodium chloride
Lyophilized from 0.22 µm filtered solution.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with sterile deionized water to a concentration of 400 µg/ml.
General Info
-
Alternative names
- Antigen identified by monoclonal antibody 1D8
- Antigenic surface determinant protein OA3
- CD 47
see all -
Function
Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. Plays an important role in memory formation and synaptic plasticity in the hippocampus (By similarity). Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. May play a role in membrane transport and/or integrin dependent signal transduction. May prevent premature elimination of red blood cells. May be involved in membrane permeability changes induced following virus infection. -
Tissue specificity
Very broadly distributed on normal adult tissues, as well as ovarian tumors, being especially abundant in some epithelia and the brain. -
Sequence similarities
Contains 1 Ig-like V-type (immunoglobulin-like) domain. -
Cellular localization
Cell membrane. - Information by UniProt
Images
-
ab220571 on SDS-PAGE under reducing (lane 1) and no-reducing (lane 2) conditions. The gel was stained overnight with Coomassie Blue. As a result of glycosylation, the reduced protein migrates at 50-66 kDa and the non-reduced protein migrates at 100-130 kDa.
-
Immobilized Mouse SIRP alpha, Mouse IgG2a Fc Tag at 10 μg/mL (100 μL/well) can bind Rat CD47, Fc Tag (ab220571) with a linear range of 2-20 ng/mL.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab220571 has not yet been referenced specifically in any publications.