Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Rat
    • Sequence

      QLLLSKVKSVEFTSCNDTVVIPCKVLNVEAQSTDEMFVKWKLNKSYIFIY DGNKNSTTREQNFTSAKISVSDLLKGIASLTMDTHEAVVGNYTCEVTELS REGKTVIELKNRPVSWFSTNEK
    • Molecular weight

      40 kDa
    • Amino acids

      19 to 140
    • Additional sequence information

      This protein carries a human IgG1 Fc tag at the C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab220571 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.61% Tris, 0.75% Glycine, 5% Trehalose, 0.44% L-Arginine, 0.87% Sodium chloride

    Lyophilized from 0.22 µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/mL. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • Antigen identified by monoclonal antibody 1D8
    • Antigenic surface determinant protein OA3
    • CD 47
    • CD47
    • CD47 antigen
    • CD47 antigen (Rh-related antigen, integrin-associated signal transducer)
    • CD47 glycoprotein
    • CD47 molecule
    • CD47_HUMAN
    • IAP
    • Integrin Associated Protein
    • Integrin associated signal transducer
    • Integrin-associated protein
    • Leukocyte surface antigen CD47
    • MER 6
    • MER6
    • OA 3
    • OA3
    • OTTHUMP00000041152
    • OTTHUMP00000041153
    • Protein MER6
    • Rh related antigen
    • Surface antigen identified by monoclonal antibody 1D8
    see all
  • Function

    Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. Plays an important role in memory formation and synaptic plasticity in the hippocampus (By similarity). Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. May play a role in membrane transport and/or integrin dependent signal transduction. May prevent premature elimination of red blood cells. May be involved in membrane permeability changes induced following virus infection.
  • Tissue specificity

    Very broadly distributed on normal adult tissues, as well as ovarian tumors, being especially abundant in some epithelia and the brain.
  • Sequence similarities

    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • ab220571 on SDS-PAGE under reducing (lane 1) and no-reducing (lane 2) conditions. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%.  As a result of glycosylation, the reduced protein migrates at 50-66 kDa and the non-reduced protein migrates at 100-130 kDa.

  • Immobilized Mouse SIRP alpha, Mouse IgG2a Fc Tag at 10 μg/mL (100 μL/well) can bind Rat CD47, Fc Tag (ab220571) with a linear range of 2-20 ng/mL 

References

ab220571 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220571.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up