Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Rat
    • Sequence

      AFAEQTPLTLHRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLD SVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPT EGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGL FEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM
    • Molecular weight

      23 kDa
    • Amino acids

      2 to 200

Associated products

Specifications

Our Abpromise guarantee covers the use of ab123755 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Fully biologically active by its ability to phosphorylate STAT3 in several cells lines.
  • Applications

    SDS-PAGE

  • Purity

    > 95 % SDS-PAGE.
    ab123755 is purified by proprietary chromatographic techniques. Purity by SDS-PAGE and gel filtration is greater than 99%.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20ºC.

    Constituent: 0.025% Sodium carbonate

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Centrifuge the vial prior to opening. Reconstitute in sterile ddH2O or 0.4 % NaHCO3 adjusted to pH 8-9 to a concentration of 100 µg/ml. This solution can then be diluted into other aqueous buffer, preferably in the presence of carrier protein. Reconstituted CNTF should be stored at 4°C for 2-7 days and as working aliquots at -20°C for future use. Avoid freeze/thaw cycles.

General Info

  • Alternative names

    • Ciliary neurotrophic factor
    • CNTF
    • CNTF_HUMAN
    • HCNTF
  • Function

    CNTF is a survival factor for various neuronal cell types. Seems to prevent the degeneration of motor axons after axotomy.
  • Tissue specificity

    Nervous system.
  • Sequence similarities

    Belongs to the CNTF family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

References

ab123755 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab123755.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up