Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Rat
    • Sequence

      AFAEQTPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNINLD SVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPT EGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGL FEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQMA FAEQTPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDS VDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTE GDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLF EKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM
    • Molecular weight

      23 kDa
    • Amino acids

      2 to 200

Associated products

Specifications

Our Abpromise guarantee covers the use of ab129035 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured in a cell proliferation assay using TF1 Human erythroleukemic cells. The ED50 for this effect is typically 3 - 15 ng/ml.
  • Applications

    Functional Studies

    SDS-PAGE

  • Purity

    > 98 % SDS-PAGE.
    Purity determined by SDS-PAGE and HPLC.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Store under desiccating conditions.

    pH: 8.00
    Constituent: 0.06% Tris

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    ab129035 is soluble in water and most aqueous buffers. The lyophilized protein should be reconstituted in water to a concentration of 100 µg/ml. This solution can be diluted with water or other buffered solutions or stored at -20°C for future use. Reconstituted ab129035 should be stored in working aliquots at -20°C. Avoid repeated freeze-thaw cycles.

General Info

  • Alternative names

    • Ciliary neurotrophic factor
    • CNTF
    • CNTF_HUMAN
    • HCNTF
  • Function

    CNTF is a survival factor for various neuronal cell types. Seems to prevent the degeneration of motor axons after axotomy.
  • Tissue specificity

    Nervous system.
  • Sequence similarities

    Belongs to the CNTF family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab129035.
    Sample was loaded in 15% SDS-polyacrylamide gel and stained with Coomassie blue.
  • Proliferation assay with TF1 cells.

References

ab129035 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab129035.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up