Description

  • Product name

    Recombinant rat CNTF protein
    See all CNTF proteins and peptides
  • Biological activity

    Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using Human TF-1 cells is less than 30 ng/mL, corresponding to a specific activity of > 3.3 × 104 IU/mg.

  • Purity

    > 95 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rat
    • Sequence

      AFAEQTPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNINLD SVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPT EGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGL FEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM
    • Predicted molecular weight

      23 kDa
    • Amino acids

      2 to 200

Associated products

Specifications

Our Abpromise guarantee covers the use of ab202798 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 2% Trehalose, 97% PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.

General Info

  • Alternative names

    • Ciliary neurotrophic factor
    • CNTF
    • CNTF_HUMAN
    • HCNTF
  • Function

    CNTF is a survival factor for various neuronal cell types. Seems to prevent the degeneration of motor axons after axotomy.
  • Tissue specificity

    Nervous system.
  • Sequence similarities

    Belongs to the CNTF family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

References

ab202798 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202798.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up