Overview

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected insect cells
  • Amino Acid Sequence
    • Accession
    • Species

      Rat
    • Sequence

      QKHSPQEAPHVQYERLGTDVTLPCGTASWDAAVTWRVNGTDLAPDLLNGS QLILRSLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNTYP KGFYCSWHLSAPTYIPNTFNVTVLHGSKMMVCEKDPALKNRCHIRYMHLF STIKYKVSISVSNALGHNTTAITFDEFTIVKPDPPENVVARPVPSNPRRL EVTWQTPSTWPDPESFPLKFFLRYRPLILDQWQHVELSNGTAHTITDAYA GKEYIIQVAAKDNEIGTWSDWSVAAHATPWTEEPRHLTTEAQAPETTTST TSSLAPPPTTKICDPGELSSLEHHHHHH
    • Molecular weight

      37 kDa including tags
    • Amino acids

      23 to 342
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 23 to 342. The signal peptide and propeptide are not included (NP_001003929).

Specifications

Our Abpromise guarantee covers the use of ab219463 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 90 % SDS-PAGE.
    ab219463 was purified using conventional chromatography techniques.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 10% Glycerol, 90% PBS

General Info

  • Alternative names

    • Ciliary neurotrophic factor receptor
    • Ciliary neurotrophic factor receptor alpha
    • Ciliary neurotrophic factor receptor subunit alpha
    • CNTF Receptor alpha
    • CNTF receptor subunit alpha
    • CNTFR
    • CNTFR Alpha
    • CNTFR-alpha
    • CNTFR_HUMAN
    see all
  • Function

    Binds to CNTF. The alpha subunit provides the receptor specificity.
  • Tissue specificity

    Nervous system and skeletal muscle.
  • Sequence similarities

    Belongs to the type I cytokine receptor family. Type 3 subfamily.
    Contains 2 fibronectin type-III domains.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
  • Domain

    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab219463.

    Molecular Weight: 40-57 kDa SDS-PAGE under reducing conditions.

References

ab219463 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219463.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up