Description

  • Product name

    Recombinant Rat CTRP3 protein (His tag)
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 0.100 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rat
    • Sequence

      QDEYMEVSRRANKAVARIVQSHQQTGRSGSRREKVREQSHAKTGTVDNNT STDLKSLRPDELPHPEVEDLAQINPFWGQSPQAGGLPPDCSKCCHGDYGF RGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERG QHGPKGEKGYPGVPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFD VMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYETKG KSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK
    • Predicted molecular weight

      32 kDa
    • Amino acids

      23 to 319
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is for the mature full length protein. The signal peptide is not included (NP_001127908.1).

Specifications

Our Abpromise guarantee covers the use of ab214597 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C long term. Avoid freeze / thaw cycle. Stable for 12 months at -20°C.

    pH: 7.40
    Constituent: 100% PBS

    Lyophilized from 0.2 µm-filtered solution.

  • Reconstitution
    Reconstitute vial with 100 µl sterile water to a concentration of 0.1mg/ml. Add 1X PBS to the desired protein concentration. PBS containing at least 0.1% BSA should be used for further dilutions.

General Info

  • Alternative names

    • C1ATNF3
    • C1q and tumor necrosis factor related protein 3
    • C1QT3_HUMAN
    • C1qtnf3
    • Cartonectin
    • Collagenous repeat containing sequence of 26 kDa
    • collagenous repeat-containing sequence 26 kDa protein
    • Complement C1q tumor necrosis factor related protein 3
    • Complement C1q tumor necrosis factor-related protein 3
    • Corcs
    • Cors
    • CORS 26
    • CORS26
    • CTRP3
    • FLJ37576
    • OTTHUMP00000115918
    • OTTHUMP00000219981
    • PRO1484
    • Secretory protein CORS26
    • UNQ753
    see all
  • Sequence similarities

    Contains 1 C1q domain.
    Contains 1 collagen-like domain.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab214597 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214597.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up