Description

  • Product name

    Recombinant rat CX3CL1 protein
    See all CX3CL1 proteins and peptides
  • Biological activity

    Fully biologically active when compared to standard.

    The biological activity determined by a chemotaxis bioassay using Human monocytes is in a concentration of 5.0-10 ng/ml.

  • Purity

    > 95 % SDS-PAGE.
    >95% by HPLC analysis.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rat
    • Sequence

      QHLGMTKCNITCHKMTSPIPVTLLIHYQLNQESCGKRAIILETRQHRHFC ADPKEKWVQDAMKHLDHQTAALTRNG
    • Predicted molecular weight

      9 kDa
    • Amino acids

      25 to 100
    • Additional sequence information

      Single non-glycosylated polypeptide chain.

Specifications

Our Abpromise guarantee covers the use of ab201406 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    HPLC

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    Lyophilised from a 0.2µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Briefly centrifuge the vial prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at -20°C to -70°C. Further dilutions should be made in appropriate buffered solutions.

General Info

  • Alternative names

    • A 152E5.2
    • AB030188
    • ABCD 3
    • ABCD3
    • AI848747
    • C-X3-C motif chemokine 1
    • C3Xkine
    • Chemokine (C-X3-C motif) ligand 1
    • Chemokine C X3 C motif ligand 1
    • Chemokine CX3C Motif Ligand 1
    • CX3C membrane anchored chemokine
    • CX3C membrane-anchored chemokine
    • Cx3cl1
    • CXC 3
    • CXC3
    • CXC3C
    • D8Bwg0439e
    • FKN
    • Fractalkine
    • Neurotactin
    • NTN
    • NTT
    • Processed fractalkine
    • SCYD 1
    • SCYD1
    • Small inducible cytokine D1
    • Small inducible cytokine subfamily D (Cys X3 Cys) member 1
    • small inducible cytokine subfamily D (Cys-X3-Cys), member 1 (fractalkine, neurotactin)
    • Small inducible cytokine subfamily D member 1
    • Small-inducible cytokine D1
    • X3CL1_HUMAN
    see all
  • Function

    The soluble form is chemotactic for T-cells and monocytes, but not for neutrophils. The membrane-bound form promotes adhesion of those leukocytes to endothelial cells. May play a role in regulating leukocyte adhesion and migration processes at the endothelium. Binds to CX3CR1.
  • Tissue specificity

    Small intestine, colon, testis, prostate, heart, brain, lung, skeletal muscle, kidney and pancreas.
  • Sequence similarities

    Belongs to the intercrine delta family.
  • Post-translational
    modifications

    A soluble short 95 kDa form may be released by proteolytic cleavage from the long membrane-anchored form.
    O-glycosylated with core 1 or possibly core 8 glycans.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt

References

ab201406 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201406.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up