Description

  • Product name

    Recombinant rat CXCL14 protein (Active)
    See all CXCL14 proteins and peptides
  • Biological activity

    Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 1.0-10 ng/ml.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rat
    • Sequence

      SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSMSRYRGQEHC LHPKLQSTKRFIKWYNAWNEKRRVYEE
    • Predicted molecular weight

      9 kDa
    • Amino acids

      23 to 99
    • Additional sequence information

      Full-length mature chain lacking the signal peptide.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab243759 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: PBS

    0.2 µm filtered

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at =-20 °C. Further dilutions should be made in appropriate buffered solutions.

General Info

  • Alternative names

    • 1110031L23Rik
    • 1200006I23Rik
    • AI414372
    • BMAC
    • bolekine
    • BRAK
    • Breast and kidney
    • C-X-C motif chemokine 14
    • C-X-C motif chemokine ligand 14
    • Chaemokine, CXC motif, ligand 14
    • Chemokine (C-X-C motif) ligand 14
    • Chemokine BRAK
    • CXC chemokine in breast and kidney
    • CXCL14
    • CXL14_HUMAN
    • JSC
    • Kec
    • Kidney-expressed chemokine CXC
    • KS1
    • MGC10687
    • MGC124510
    • MGC90667
    • MIP 2 gamma
    • MIP-2G
    • MIP2G
    • MIP2gamma
    • NJAC
    • PRO273
    • PSEC0212
    • Scyb14
    • Small Inducible Cytokine B14
    • Small inducible cytokine subfamily B (Cys-X-Cys) member 14 (BRAK)
    • Small Inducible Cytokine subfamily B, member 14
    • Small-inducible cytokine B14
    • Tumor suppressing chemokine
    • UNQ240
    see all
  • Function

    Potent chemoattractant for neutrophils, and weaker for dendritic cells. Not chemotactive for T-cells, B-cells, monocytes, natural killer cells or granulocytes. Does not inhibit proliferation of myeloid progenitors in colony formation assays.
  • Tissue specificity

    Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Highly expressed in normal tissue without inflammatory stimuli and infrequently expressed in cancer cell lines. Weakly expressed in monocyte-derived dendritic cells. Not detected in lung or unstimulated peripheral blood lymphocytes.
  • Sequence similarities

    Belongs to the intercrine alpha (chemokine CxC) family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab243759

References

ab243759 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243759.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up