Description

  • Product name

    Recombinant rat CXCL17/DMC protein (Active)
    See all CXCL17/DMC proteins and peptides
  • Biological activity

    Fully biologically active when compared to standard. The ED50 as determined by its ability to induce VEGF expression using murine endothelial cells is less than 5.0 μg/ml, corresponding to a specific activity of >200 IU/mg

  • Purity

    > 97 % SDS-PAGE.
    >97% as determined by SDS-PAGE and HPLC.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rat
    • Sequence

      SPNQEVARHHGDQHQAPRRWLWEGGQECDCKDWSLRVSKRKTTAVLEPPR KQCPCDHVKGSEKKNRRQKHHRKSQRPSRTCQQFLKRCQLASFTLPL
    • Predicted molecular weight

      12 kDa
    • Amino acids

      23 to 119
    • Additional sequence information

      Full length mature chain without signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab243786 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

    HPLC

  • Form

    Lyophilised
  • Additional notes

     This product was previously labelled as CXCL17

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C or -20°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: PBS

    0.2 µm filtered

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at =-20 °C. Further dilutions should be made in appropriate buffered solutions.

General Info

  • Alternative names

    • 13.6 kDa protein
    • C-X-C motif chemokine 17
    • chemokine (C-X-C motif) ligand 17
    • CXCL17
    • Dcip1
    • Dendritic cell and monocyte chemokine-like protein
    • DMC
    • UNQ473
    • UNQ473/PRO842
    • VCC1
    • VEGF co-regulated chemokine 1
    see all
  • Relevance

    Plays a role in angiogenesis and possibly in the development of tumors. May be a housekeeping chemokine regulating recruitment of nonactivated blood monocytes and immature dendritic cells into tissues. May play a role in the innate defense against infections.
  • Cellular localization

    Secreted.

Images

  • SDS-PAGE analysis of ab243786

References

ab243786 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243786.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up