Recombinant rat CXCL2 protein (ab201362)
Key features and details
- Expression system: Escherichia coli
- Purity: > 98% SDS-PAGE
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies, HPLC
Description
-
Product name
Recombinant rat CXCL2 protein
See all CXCL2 proteins and peptides -
Biological activity
Fully biologically active when compared to standard.
The biological activity determined by a chemotaxis bioassay using Rat neutrophils is in a concentration range of 10-100 ng/mL.
-
Purity
> 98 % SDS-PAGE.
> 98 % by HPLC analysis. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Rat -
Sequence
VVVASELRCQCLTTLPRVDFKNIQSLTVTPPGPHCAQTEVIATLKDGHEV CLNPEAPLVQRIVQKILNKGKAN -
Predicted molecular weight
8 kDa -
Amino acids
28 to 100 -
Additional sequence information
Single, non-glycosylated polypeptide chain containing 73 amino acids.
-
Specifications
Our Abpromise guarantee covers the use of ab201362 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
HPLC
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.
pH: 7.40
Constituent: 100% PBS
Lyophilized from a 0.2 µM filtered solution.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionBriefly centrifuge the vial prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.
General Info
-
Alternative names
- C-X-C motif chemokine 2
- Chemokine (C X C motif) ligand 2
- Chemokine, CXC motif, ligand 2
see all -
Function
Produced by activated monocytes and neutrophils and expressed at sites of inflammation. Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. GRO-beta(5-73) shows a highly enhanced hematopoietic activity. -
Sequence similarities
Belongs to the intercrine alpha (chemokine CxC) family. -
Post-translational
modificationsThe N-terminal processed form GRO-beta(5-73) is produced by proteolytic cleavage after secretion from bone marrow stromal cells. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab201362 has not yet been referenced specifically in any publications.