Description

  • Product name

    Recombinant rat CXCL2 protein
    See all CXCL2 proteins and peptides
  • Biological activity

    Fully biologically active when compared to standard.

    The biological activity determined by a chemotaxis bioassay using Rat neutrophils is in a concentration range of 10-100 ng/mL.

  • Purity

    > 98 % SDS-PAGE.
    > 98 % by HPLC analysis.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rat
    • Sequence

      VVVASELRCQCLTTLPRVDFKNIQSLTVTPPGPHCAQTEVIATLKDGHEV CLNPEAPLVQRIVQKILNKGKAN
    • Predicted molecular weight

      8 kDa
    • Amino acids

      28 to 100
    • Additional sequence information

      Single, non-glycosylated polypeptide chain containing 73 amino acids.

Specifications

Our Abpromise guarantee covers the use of ab201362 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    Lyophilized from a 0.2 µM filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Briefly centrifuge the vial prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.

General Info

  • Alternative names

    • C-X-C motif chemokine 2
    • Chemokine (C X C motif) ligand 2
    • Chemokine, CXC motif, ligand 2
    • CINC 2a
    • CINC2a
    • CINC3
    • CXC chemokine
    • CXCL 2
    • Cxcl2
    • CXCL2_HUMAN
    • Cytokine-induced neutrophil chemoattractant 3
    • GRO 2
    • GRO b
    • GRO protein, beta
    • Gro-beta
    • GRO-beta(5-73)
    • GRO-beta-T
    • GRO2
    • GRO2 oncogene
    • GROb
    • GRObeta
    • Growth regulated protein beta
    • Growth-regulated protein beta
    • GROX
    • Hematopoietic synergistic factor
    • HSF
    • Macrophage inflammatory protein 2
    • Macrophage inflammatory protein 2 alpha
    • Macrophage inflammatory protein 2-alpha
    • Melanoma growth stimulatory activity beta
    • MGSA b
    • MGSA beta
    • MIP 2
    • MIP 2a
    • MIP2
    • MIP2 alpha
    • MIP2-alpha
    • MIP2A
    • MIP2alpha
    • SB-251353
    • Scyb
    • SCYB 2
    • SCYB2
    • Small inducible cytokine subfamily B, member 2
    see all
  • Function

    Produced by activated monocytes and neutrophils and expressed at sites of inflammation. Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. GRO-beta(5-73) shows a highly enhanced hematopoietic activity.
  • Sequence similarities

    Belongs to the intercrine alpha (chemokine CxC) family.
  • Post-translational
    modifications

    The N-terminal processed form GRO-beta(5-73) is produced by proteolytic cleavage after secretion from bone marrow stromal cells.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab201362 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201362.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up