Description

  • Product name

    Recombinant Rat CXCL9 protein
    See all CXCL9 proteins and peptides
  • Expression system

    Yeast
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rat
    • Sequence

      TLVIRNQRCSCISTSQGTFHYKSLKDLKQFAPSPNCNKTEIIATLKNGDQ TCLDPDSARVKKLMKEWEKKISQKKKQKRGKNHQRSKKTRKAKTPHHPES KKTA
    • Predicted molecular weight

      12 kDa
    • Amino acids

      22 to 125
    • Additional sequence information

      This product is for the mature full length protein from aa 22 to 125. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab189234 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form

    Lyophilised
  • Additional notes

    Endotoxin-free, suitable for use in cell culture.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C long term. Avoid freeze / thaw cycle.

    Constituents: 10% Trehalose, 90% PBS

  • Reconstitution
    Reconstitute with sterile phosphate-buffered saline containing at least 0.1% carrier protein.

General Info

  • Alternative names

    • C-X-C motif chemokine 9
    • chemokine (C-X-C motif) ligand 9
    • CMK
    • crg-10
    • CXCL9
    • CXCL9_HUMAN
    • gamma interferon induced monokine
    • Gamma-interferon-induced monokine
    • HuMIG
    • MIG
    • monokine induced by gamma interferon
    • monokine induced by interferon gamma
    • Monokine induced by interferon-gamma
    • SCYB9
    • Small inducible cytokine B9
    • small inducible cytokine subfamily B member 9
    • Small-inducible cytokine B9
    see all
  • Function

    Cytokine that affects the growth, movement, or activation state of cells that participate in immune and inflammatory response. Chemotactic for activated T-cells. Binds to CXCR3.
  • Sequence similarities

    Belongs to the intercrine alpha (chemokine CxC) family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab189234 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab189234.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up