Description

  • Product name

    Recombinant Rat Cyclophilin A protein
    See all Cyclophilin A proteins and peptides
  • Purity

    > 95 % Densitometry.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rat
    • Sequence

      MKHHHHHHASVNPTVFFDITADGEPLGRVCFELFADKVPKTAENFRALST GEKGFGYKGSSFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILK HTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMSIVEA MERFGSRNGKTSKKITISDCGQL
    • Predicted molecular weight

      19 kDa including tags
    • Amino acids

      2 to 164
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab207156 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    LC-MS/MS
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    Constituents: 5% Trehalose, 95% PBS

    Lyophilised from a 0.4 µm filtered solution.

  • Reconstitution
    Add deionized water to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilised pellet dissolve completely.

General Info

  • Alternative names

    • Cyclophilin
    • Cyclophilin A
    • CyclophilinA
    • Cyclosporin A binding protein
    • Cyclosporin A-binding protein
    • CYPA
    • CYPH
    • Epididymis secretory sperm binding protein Li 69p
    • HEL S 69p
    • MGC117158
    • MGC12404
    • MGC23397
    • Peptidyl prolyl cis trans isomerase A
    • Peptidyl-prolyl cis-trans isomerase A
    • Peptidylprolyl isomerase A
    • Peptidylprolyl isomerase A (cyclophilin A)
    • PPIA
    • PPIA protein
    • PPIA_HUMAN
    • PPIase A
    • Rotamase A
    • RotamaseA
    • T cell cyclophilin
    see all
  • Function

    PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
  • Sequence similarities

    Belongs to the cyclophilin-type PPIase family. PPIase A subfamily.
    Contains 1 PPIase cyclophilin-type domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 14 % SDS-PAGE analysis of ab207156.

    Lane 1: Reduced and boiled sample, 2.5 μg/lane.
    Lane 2: Non-reduced and non-boiled sample, 2.5 μg/lane.

References

ab207156 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab207156.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up