Recombinant rat Cystatin C protein (Active) (ab219236)
Key features and details
- Expression system: Baculovirus infected insect cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Tags: His tag C-Terminus
- Suitable for: Functional Studies, SDS-PAGE
Description
-
Product name
Recombinant rat Cystatin C protein (Active)
See all Cystatin C proteins and peptides -
Biological activity
The IC50 value is < 1.0nM. The inhibitory function of ab219236 on protease activity of papain was measured by a fluorometric assay using Z-FR-AMC at pH 7.5 at 25°C.
-
Purity
> 95 % SDS-PAGE.
ab219236 was purified using conventional chromatography techniques. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
Baculovirus infected insect cells -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Rat -
Sequence
GTSRPPPRLLGAPQEADASEEGVQRALDFAVSEYNKGSNDAYHSRAIQVV RARKQLVAGINYYLDVEMGRTTCTKSQTNLTNCPFHDQPHLMRKALCSFQ IYSVPWKGTHTLTKSSCKNALEHHHHHH -
Predicted molecular weight
14 kDa including tags -
Amino acids
21 to 140 -
Tags
His tag C-Terminus -
Additional sequence information
This product is the mature full length protein from aa 21 to 140. The signal peptide is not included (NP_036969).
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab219236 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituents: 10% Glycerol (glycerin, glycerine), 90% PBSThis product is an active protein and may elicit a biological response in vivo, handle with caution.
General Info
-
Alternative names
- AD 8
- AD8
- Amyloid angiopathy and cerebral hemorrhage
see all -
Function
As an inhibitor of cysteine proteinases, this protein is thought to serve an important physiological role as a local regulator of this enzyme activity. -
Tissue specificity
Expressed in submandibular and sublingual saliva but not in parotid saliva (at protein level). Expressed in various body fluids, such as the cerebrospinal fluid and plasma. Expressed in highest levels in the epididymis, vas deferens, brain, thymus, and ovary and the lowest in the submandibular gland. -
Involvement in disease
Amyloidosis 6
Macular degeneration, age-related, 11 -
Sequence similarities
Belongs to the cystatin family. -
Post-translational
modificationsThe Thr-25 variant is O-glycosylated with a core 1 or possibly core 8 glycan. The signal peptide of the O-glycosylated Thr-25 variant is cleaved between Ala-20 and Val-21. -
Cellular localization
Secreted. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab219236 has not yet been referenced specifically in any publications.