Description

  • Product name

    Recombinant rat EGF protein
    See all EGF proteins and peptides
  • Biological activity

    The activity is determined by the dose-dependent proliferation of mouse BALB/c 3T3 cells and is typically less than 0.1 ng/mL.

  • Purity

    > 95 % SDS-PAGE.
    Protein Content and Purity (typically = 95%) determined by: HPLC, Reducing and Non-reducing SDS-PAGE, UV spectroscopy at 280 nm.
  • Endotoxin level

    <=1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rat
    • Sequence

      MNSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRW WKLR
    • Predicted molecular weight

      6 kDa
    • Amino acids

      974 to 1026
    • Additional sequence information

      This product is for the mature full length protein. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab198562 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).

    pH: 7.50
    Constituent: 0.16% Sodium phosphate

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product with sterile water at a concentration of 0.1 mg/mL, which can be further diluted into other aqueous solutions.

General Info

  • Alternative names

    • Beta urogastrone
    • beta-urogastrone
    • EGF
    • EGF_HUMAN
    • Epidermal growth factor
    • HOMG4
    • OTTHUMP00000219721
    • OTTHUMP00000219722
    • Pro epidermal growth factor
    • URG
    • Urogastrone
    see all
  • Function

    EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR and activation of the magnesium channel TRPM6. Can induce neurite outgrowth in motoneurons of the pond snail Lymnaea stagnalis in vitro (PubMed:10964941).
  • Tissue specificity

    Expressed in kidney, salivary gland, cerebrum and prostate.
  • Involvement in disease

    Hypomagnesemia 4
  • Sequence similarities

    Contains 9 EGF-like domains.
    Contains 9 LDL-receptor class B repeats.
  • Post-translational
    modifications

    O-glycosylated with core 1-like and core 2-like glycans. It is uncertain if Ser-954 or Thr-955 is O-glycosylated. The modification here shows glycan heterogeneity: HexHexNAc (major) and Hex2HexNAc2 (minor).
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab198562 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198562.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up