Recombinant rat FGF10 protein (ab203715)
Key features and details
- Expression system: Escherichia coli
- Purity: > 97% SDS-PAGE
- Active: Yes
- Suitable for: SDS-PAGE, HPLC, Functional Studies
Description
-
Product name
Recombinant rat FGF10 protein
See all FGF10 proteins and peptides -
Biological activity
Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using monkey 4MBr-5 cells is less than 120 ng/ml, corresponding to a specific activity of > 8.3 × 103 IU/mg.
-
Purity
> 97 % SDS-PAGE.
> 97 % by HPLC. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Rat -
Sequence
QALGQDMVSPEATNSSSSSSSSSSSSSFSSPSSAGRHVRSYNHLQGDVRW RKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSN YYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVA LNGKGAPRRGQKTRRKNTSAHFLPMVVHS -
Predicted molecular weight
20 kDa -
Amino acids
37 to 215 -
Additional sequence information
This product is for the mature full length protein. The signal peptide is not included.
-
Specifications
Our Abpromise guarantee covers the use of ab203715 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
HPLC
Functional Studies
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C long term. Avoid freeze / thaw cycle.
pH: 7.40
Constituents: 5% Trehalose, 2.9% Sodium chloride, 0.24% TrisThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.
General Info
-
Alternative names
- BB213776
- fd11d03
- FGF 10
see all -
Function
Could be a growth factor active in the process of wound healing. Acts as a mitogen in the lung. May act in a manner similar to FGF-7. -
Involvement in disease
Defects in FGF10 are the cause of autosomal dominant aplasia of lacrimal and salivary glands (ALSG) [MIM:180920]. ALSG has variable expressivity, and affected individuals may have aplasia or hypoplasia of the lacrimal, parotid, submandibular and sublingual glands and absence of the lacrimal puncta. The disorder is characterized by irritable eyes, recurrent eye infections, epiphora (constant tearing) and xerostomia (dryness of the mouth), which increases the risk of dental erosion, dental caries, periodontal disease and oral infections.
Defects in FGF10 are a cause of lacrimo-auriculo-dento-digital syndrome (LADDS) [MIM:149730]; also known as Levy-Hollister syndrome. LADDS is a form of ectodermal dysplasia, a heterogeneous group of disorders due to abnormal development of two or more ectodermal structures. LADDS is an autosomal dominant syndrome characterized by aplastic/hypoplastic lacrimal and salivary glands and ducts, cup-shaped ears, hearing loss, hypodontia and enamel hypoplasia, and distal limb segments anomalies. In addition to these cardinal features, facial dysmorphism, malformations of the kidney and respiratory system and abnormal genitalia have been reported. Craniosynostosis and severe syndactyly are not observed. -
Sequence similarities
Belongs to the heparin-binding growth factors family. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab203715 has not yet been referenced specifically in any publications.