Description

  • Product name

    Recombinant rat FGF18 protein
    See all FGF18 proteins and peptides
  • Biological activity

    Fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 106 IU/mg.

  • Purity

    > 95 % SDS-PAGE.
    > 95 % by HPLC.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rat
    • Sequence

      EENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARG EDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKEC VFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKR YPKGQTELQKPFKYTTVTKRSRRIRPTHPG
    • Predicted molecular weight

      21 kDa
    • Amino acids

      28 to 207
    • Additional sequence information

      This product is for the mature full length protein. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab202784 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 97% PBS, 2.92% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

General Info

  • Alternative names

    • FGF 18
    • FGF-18
    • Fgf18
    • FGF18_HUMAN
    • FGFI
    • Fibroblast growth factor 18
    • zFGF5
    see all
  • Function

    Plays an important role in the regulation of cell proliferation, cell differentiation and cell migration. Required for normal ossification and bone development. Stimulates hepatic and intestinal proliferation.
  • Sequence similarities

    Belongs to the heparin-binding growth factors family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab202784 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202784.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up