Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Rat
    • Sequence

      PALPEDGGGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHV KLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESN NYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
    • Molecular weight

      16 kDa
    • Amino acids

      10 to 154
    • Additional sequence information

      Single non-glycosylated polypeptide chain containing 145 amino acids. This product is the mature full length protein from aa 10 to 154. The propeptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab200240 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Fully biologically active when compared to standard.

    The ED50 as determined by the dose-dependent stimulation of thymidine uptake by 3T3 cells is ≤ 0.2 ng/ml, corresponding to a specific activity of ≥5 x 10units/mg.

  • Applications

    Functional Studies

    HPLC

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 98 % SDS-PAGE.
    Purity: >98% by SDS-PAGE and HPLC analyses.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    Lyophilized from a 0.2mm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at -20°C to -70°C. Further dilutions should be made in appropriate buffered solutions.

General Info

  • Alternative names

    • Basic fibroblast growth factor
    • Basic fibroblast growth factor bFGF
    • BFGF
    • FGF 2
    • FGF B
    • FGF-2
    • Fgf2
    • FGF2 basic
    • FGF2_HUMAN
    • FGFB
    • Fibroblast growth factor 2
    • Fibroblast growth factor 2 (basic)
    • Fibroblast growth factor, basic
    • HBGF 2
    • HBGF-2
    • HBGF2
    • HBGH 2
    • HBGH2
    • Heparin binding growth factor 2 precursor
    • Heparin-binding growth factor 2
    • Prostatropin
    see all
  • Function

    Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Can induce angiogenesis (PubMed:23469107).
  • Tissue specificity

    Expressed in granulosa and cumulus cells. Expressed in hepatocellular carcinoma cells, but not in non-cancerous liver tissue.
  • Sequence similarities

    Belongs to the heparin-binding growth factors family.
  • Post-translational
    modifications

    Phosphorylation at Tyr-215 regulates FGF2 unconventional secretion.
    Several N-termini starting at positions 94, 125, 126, 132, 143 and 162 have been identified by direct sequencing.
  • Cellular localization

    Secreted. Nucleus. Exported from cells by an endoplasmic reticulum (ER)/Golgi-independent mechanism. Unconventional secretion of FGF2 occurs by direct translocation across the plasma membrane. Binding of exogenous FGF2 to FGFR facilitates endocytosis followed by translocation of FGF2 across endosomal membrane into the cytosol. Nuclear import from the cytosol requires the classical nuclear import machinery, involving proteins KPNA1 and KPNB1, as well as CEP57.
  • Information by UniProt

References

ab200240 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab200240.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up