Description

  • Product name

    Recombinant rat FGF21 protein
    See all FGF21 proteins and peptides
  • Biological activity

    ab202819 is fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 0.5 μg/mL, corresponding to a specific activity of > 2.0 × 103 IU/mg in the presence of 5 µg/mL of rMuKlotho-β and 10 μg/mL of heparin.

  • Purity

    > 95 % SDS-PAGE.
    Purity is determined by SDS-PAGE and HPLC analyses.
  • Endotoxin level

    > 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rat
    • Sequence

      AYPISDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGTAHRSP ESLLELKALKPGVIQILGVKASRFLCQQPDGTLYGSPHFDPEACSFRELL LKDGYNVYQSEAHGLPLRLPQKDSQDPATRGPVRFLPMPGLPHEPQEQPG VLPPEPPDVGSSDPLSMVEPLQGRSPSYAS
    • Predicted molecular weight

      20 kDa
    • Amino acids

      29 to 208
    • Additional sequence information

      This product is for the mature full length protein. The signal peptide is not included. A single non-glycosylated polypeptide chain.

Specifications

Our Abpromise guarantee covers the use of ab202819 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    HPLC

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 2.9% Sodium chloride, 97% PBS

    Lyophilized from a 0.2 µM filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions. Reconstituted protein should be stored in working aliquots and stored at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

General Info

  • Alternative names

    • FGF 21
    • FGF-21
    • Fgf21
    • FGF21_HUMAN
    • FGFL
    • Fibroblast growth factor 21
    • PRO10196
    • UNQ3115
    see all
  • Function

    Stimulates glucose uptake in differentiated adipocytes via the induction of glucose transporter SLC2A1/GLUT1 expression (but not SLC2A4/GLUT4 expression). Activity requires the presence of KLB.
  • Sequence similarities

    Belongs to the heparin-binding growth factors family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab202819 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202819.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up