Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Rat
    • Sequence
      MKKIPLLTVSSLPPSLPLPRSFLLKSLEQVRKIQARNTELLEQLCATYKL CHPEELVLFGHSLGIPKASLSSCSSQALQQTKCLSQLHSGLFLYQGLLQA LAGISSELAPTLDMLHLDVDNFATTIWQQMESLGVAPTVQPTQSTMPIFT SAFQRRAGGVLVTSYLQSFLETAHHALHHLPRPAQKHFPESLFISI
    • Molecular weight
      22 kDa
    • Amino acids
      22 to 214

Specifications

Our Abpromise guarantee covers the use of ab176083 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Determined by its ability to stimulate the proliferation of mouse NFS-60 cells. The expected ED50 is ≤ 0.05 ng/ml, corresponding to a specific activity of ≥ 2 x 107 units/mg.

  • Applications

    Functional Studies

    HPLC

    SDS-PAGE

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    >= 98 % SDS-PAGE.

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1-1.0 mg/ml. Do not vortex. This solution can be stored at 2-8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.

General Info

  • Alternative names
    • C17orf33
    • Colony stimulating factor 3
    • Colony stimulating factor 3 (granulocyte)
    • CSF 3
    • CSF beta
    • CSF3
    • CSF3_HUMAN
    • CSF3OS
    • Csfg
    • Filgrastim
    • G-CSF
    • GCSA
    • GCSF
    • Granulocyte colony stimulating factor
    • Granulocyte colony-stimulating factor
    • Lenograstim
    • Macrophage granulocyte inducer 2
    • MGC45931
    • MGI 2
    • Pluripoietin
    see all
  • Function
    Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. This CSF induces granulocytes.
  • Sequence similarities
    Belongs to the IL-6 superfamily.
  • Post-translational
    modifications
    O-glycan consists of Gal-GalNAc disaccharide which can be modified with up to two sialic acid residues (done in recombinantly expressed G-CSF from CHO cells).
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab176083 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176083.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up