Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Rat
    • Sequence

      MAPTRSPNPVTRPWKHVDAIKEALSLLNDMRALENEKNEDVDIISNEFSI QRPTCVQTRLKLYKQGLRGNLTKLNGALTMIASHYQTNCPPTPETDCEIE VTTFEDFIKNLKGFLFDIPFDCWKPVQK
    • Molecular weight

      15 kDa
    • Amino acids

      18 to 144
    • Additional sequence information

      This product is for the mature full length protein. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab198565 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    The activity is determined by the dose-dependent proliferation of mouse FDC-P1 cell line and is typically less than 100 pg/mL.

  • Applications

    SDS-PAGE

    HPLC

    Functional Studies

  • Endotoxin level

    <=1.000 Eu/µg
  • Purity

    >= 97 % SDS-PAGE.
    Protein Content and Purity (typically = 97%) determined by: UV spectroscopy at 280 nm. RP-HPLC calibrated against a known standard. Quantitation against a known standard via reducing and non-reducing SDS-PAGE gels.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product with sterile water at a concentration of 0.1 mg/mL, which can be further diluted into other aqueous solutions.

General Info

  • Alternative names

    • Colony stimulating factor
    • Colony Stimulating Factor 2
    • Colony stimulating factor 2 (granulocyte-macrophage)
    • Colony-stimulating factor
    • CSF
    • CSF 2
    • CSF2
    • CSF2_HUMAN
    • GM-CSF
    • GMCSF
    • Granulocyte Macrophage Colony Stimulating Factor
    • Granulocyte-macrophage colony-stimulating factor
    • MGC131935
    • MGC138897
    • MGI1GM
    • Molgramostin
    • Pluripoietin-a
    • Sargramostim
    see all
  • Function

    Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes.
  • Sequence similarities

    Belongs to the GM-CSF family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab198565 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198565.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up