Recombinant Rat Gremlin 1 protein (Tagged) (ab239560)
Key features and details
- Expression system: Mammalian
- Purity: > 85% SDS-PAGE
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Rat Gremlin 1 protein (Tagged)
See all Gremlin 1 proteins and peptides -
Purity
> 85 % SDS-PAGE. -
Expression system
Mammalian -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Rat -
Sequence
KKKGSQGAIPPPDKAQHNDSEQTQSPPQPGSRTRGRGQGRGTAMPGEEVL ESSQEALHVTERKYLKRDWCKTQPLKQTIHEEGCNSRTIINRFCYGQCNS FYIPRHIRKEEGSFQSCSFCKPKKFTTMMVTLNCPELQPPTKKKRVTRVK QCRCISIDLD -
Predicted molecular weight
22 kDa including tags -
Amino acids
25 to 184 -
Additional sequence information
Full-length mature chain lacking the signal peptide. N-terminal 10xHis-tagged and C-terminal Myc-tagged
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab239560 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)
General Info
-
Alternative names
- BMP antagonist 1
- Cell proliferation inducing gene 2 protein
- Cell proliferation-inducing gene 2 protein
see all -
Function
Cytokine that may play an important role during carcinogenesis and metanephric kidney organogenesis, as a BMP antagonist required for early limb outgrowth and patterning in maintaining the FGF4-SHH feedback loop. Down-regulates the BMP4 signaling in a dose-dependent manner. Acts as inhibitor of monocyte chemotaxis. -
Tissue specificity
Highly expressed in small intestine, fetal brain and colon. Expression is restricted to intestinal subepithelial myofibroblasts (ISEMFs) at the crypt base. In subjects with HMPS1, by contrast, GREM1 is expressed, not only in basal ISEMFs, but also at very high levels in epithelial cells (predominantly colonocytes), with expression extending most of the way up the sides of the crypt. Weakly expressed in brain, ovary, prostate, pancreas and skeletal muscle. In brain found in the region localized around the internal capsule in the large subcortical nuclei, including caudate, putamen, substantia nigra, thalamus and subthalamus. Predominantly expressed in normal cells including neurons, astrocytes and fibroblasts. -
Involvement in disease
Polyposis syndrome, mixed hereditary 1 -
Sequence similarities
Belongs to the DAN family.
Contains 1 CTCK (C-terminal cystine knot-like) domain. -
Cellular localization
Secreted. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab239560 has not yet been referenced specifically in any publications.