Description

  • Product name

    Recombinant rat GRO alpha protein
    See all GRO alpha proteins and peptides
  • Endotoxin level

    < 0.100 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rat
    • Sequence

      APVANELRCQCLQTVAGIHFKNIQSLKVMP PGPHCTQTEVIATLKNGREACLDPEAPMVQ KIVQKMLKGVPK
    • Predicted molecular weight

      11 kDa
    • Amino acids

      25 to 96

Associated products

Specifications

Our Abpromise guarantee covers the use of ab9773 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

    Western blot

  • Form

    Lyophilised
  • Additional notes

    The maximal chemotactic activity of rat GRO on rat neutrophils was determined by its ability to chemoattract rat neutrophils using a concentration range of 10.0-100.0 ng/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    n/a

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    For lot specific reconstitution information please contact our Scientific Support Team.

General Info

  • Alternative names

    • C-X-C motif chemokine 1
    • chemokine (C-X-C motif) ligand 1
    • Chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha)
    • CINC-1
    • CXCL1
    • Cytokine-induced neutrophil chemoattractant 1
    • Fibroblast secretory protein
    • Fsp
    • Gro
    • Gro 1
    • Gro A
    • GRO protein, alpha
    • GRO-alpha(1-73)
    • GRO-alpha(6-73)
    • Gro1
    • Gro1 oncogene
    • GRO1 oncogene (melanoma growth stimulating activity, alpha)
    • GRO1 oncogene (melanoma growth-stimulating activity)
    • GROa
    • GROA_HUMAN
    • Growth-regulated alpha protein
    • KC
    • KC chemokine, mouse, homolog of
    • Melanoma growth stimulatory activity
    • melanoma growth stimulatory activity alpha
    • Melanoma growth stimulatory activity, alpha
    • MGSA
    • MGSA alpha
    • MGSA-a
    • N51
    • NAP-3
    • NAP3
    • Neutrophil-activating protein 3
    • Platelet-derived growth factor-inducible protein KC
    • Scyb 1
    • Scyb1
    • Secretory protein N51
    • Small inducible cytokine subfamily B, member 1
    see all
  • Function

    Has chemotactic activity for neutrophils. May play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. In vitro, the processed forms GRO-alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) show a 30-fold higher chemotactic activity.
  • Sequence similarities

    Belongs to the intercrine alpha (chemokine CxC) family.
  • Post-translational
    modifications

    N-terminal processed forms GRO-alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) are produced by proteolytic cleavage after secretion from peripheral blood monocytes.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

References

ab9773 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab9773.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up