Description

  • Product name

    Recombinant Rat Hemopexin protein (His tag)
    See all Hemopexin proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rat
    • Sequence

      NPLPAAHETVAKGENGTKPDSDVIEHCSDAWSFDATTMDHNGTMLFFKGE FVWRGHSGIRELISERWKNPVTSVDAAFRGPDSVFLIKEDKVWVYPPEKK ENGYPKLFQEEFPGIPYPPDAAVECHRGECQSEGVLFFQGNRKWFWDFAT RTQKERSWPAVGNCTAALRWLERYYCFQGNKFLRFNPVTGEVPPRYPLDA RDYFISCPGRGHGKLRNGTAHGNSTHPMHSRCNADPGLSALLSDHRGATY AFSGSHYWRLDSSRDGWHSWPIAHHWPQGPSAVDAAFSWDEKVYLIQGTQ VYVFLTKGGNNLVSGYPKRLEKELGSPPGISLDTIDAAFSCPGSSKLYVT SGRRLWWLDLKSGAQATWAELSWPHEKVDGALCLEKSLGPYSCSSNGPNL FFIHGPNLYCYSSIDKLNAAKSLPQPQKVNSILGCSQ
    • Predicted molecular weight

      53 kDa including tags
    • Amino acids

      24 to 460
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 24 to 406. The signal peptideis not included.

Specifications

Our Abpromise guarantee covers the use of ab235568 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    LC-MS/MS
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • Beta 1B glycoprotein
    • Beta-1B-glycoprotein
    • FLJ56652
    • HEMO
    • HEMO_HUMAN
    • Hemopexin
    • Hpx
    • HX
    see all
  • Function

    Binds heme and transports it to the liver for breakdown and iron recovery, after which the free hemopexin returns to the circulation.
  • Tissue specificity

    Expressed by the liver and secreted in plasma.
  • Sequence similarities

    Belongs to the hemopexin family.
    Contains 5 hemopexin-like domains.
  • Post-translational
    modifications

    N- and O-glycosylated. O-glycosylated with core 1 or possibly core 8 glycans.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab235568.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab235568 could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Hemopexin.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab235568 could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Hemopexin.

References

ab235568 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235568.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up