Description

  • Product name

    Recombinant Rat IGFBP1 protein
    See all IGFBP1 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rat
    • Sequence

      APQPWHCAPCTAERLELCPPVPASCPEISRPAGCGCCPTCALPLGAACGV ATARCAQGLSCRALPGEPRPLHALTRGQGACVLEPAAPATSSLSGSQHEE AKAAVASEDELAESPEMTEEQLLDSFHLMAPSREDQPILWNAISTYSSMR AREITDLKKWKEPCQRELYKVLERLAAAQQKAGDEIYKFYLPNCNKNGFY HSKQCETSLDGEAGLCWCVYPWSGKKIPGSLETRGDPNCHQYFNVQN
    • Predicted molecular weight

      27 kDa
    • Amino acids

      26 to 272
    • Additional sequence information

      This product is the mature full length protein from aa 26 to 272. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab226424 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • AFBP
    • Alpha pregnancy associated endometrial globulin
    • Amniotic fluid binding protein
    • Binding protein 25
    • Binding protein 26
    • Binding protein 28
    • Growth hormone independent binding protein
    • hIGFBP 1
    • hIGFBP1
    • IBP 1
    • IBP-1
    • IBP1
    • IBP1_HUMAN
    • IGF binding protein 1
    • IGF BP25
    • IGF-binding protein 1
    • IGFBP 1
    • IGFBP-1
    • IGFBP1
    • Insulin like growth factor binding protein 1
    • Insulin-like growth factor-binding protein 1
    • Placental protein 12
    • PP 12
    • PP12
    see all
  • Function

    IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Promotes cell migration.
  • Sequence similarities

    Contains 1 IGFBP N-terminal domain.
    Contains 1 thyroglobulin type-1 domain.
  • Post-translational
    modifications

    Phosphorylated; probably by casein kinase II. Alters the affinity of the protein for IGFs.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab226424 with 5% enrichment gel and 15% separation gel.

References

ab226424 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab226424.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up