Description

  • Product name

    Recombinant rat IL-1 alpha protein
    See all IL-1 alpha proteins and peptides
  • Biological activity

    The ED50 as determined by a cell proliferation assay using murine D10S cells is less than 0.005 ng/mL, corresponding to a specific activity of > 2.0 × 108 IU/mg.

  • Purity

    > 97 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rat
    • Sequence

      SAPHSFQNNLRYKLIRIVKQEFIMNDSLNQNIYVDMDRIHLKAASLNDLQ LEVKFDMYAYSSGGDDSKYPVTLKVSNTQLFVSAQGEDKPVLLKEIPETP KLITGSETDLIFFWEKINSKNYFTSAAFPELLIATKEQSQVHLARGLPSM IDFQIS
    • Predicted molecular weight

      18 kDa
    • Amino acids

      115 to 270

Specifications

Our Abpromise guarantee covers the use of ab200276 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    HPLC

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 8.5
    Constituents: 0.24% Tris buffer, 0.87% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL.

General Info

  • Alternative names

    • BAF
    • FAF
    • Hematopoietin 1
    • Hematopoietin-1
    • IL 1 alpha
    • IL 1A
    • IL-1 alpha
    • Il-1a
    • IL1
    • IL1 ALPHA
    • IL1A
    • IL1A_HUMAN
    • IL1F1
    • Interleukin 1 alpha
    • Interleukin-1 alpha
    • Interleukin1 alpha
    • LAF
    • LEM
    • Preinterleukin 1 alpha
    • Pro interleukin 1 alpha
    see all
  • Function

    Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
  • Sequence similarities

    Belongs to the IL-1 family.
  • Domain

    The similarity among the IL-1 precursors suggests that the amino ends of these proteins serve some as yet undefined function.
  • Cellular localization

    Secreted. The lack of a specific hydrophobic segment in the precursor sequence suggests that IL-1 is released by damaged cells or is secreted by a mechanism differing from that used for other secretory proteins.
  • Information by UniProt

References

ab200276 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab200276.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up