Recombinant rat IL-17A protein (Active) (ab282393)
Key features and details
- Expression system: HEK 293 cells
- Purity: >= 95% SDS-PAGE
- Endotoxin level: <= 0.005 Eu/µg
- Active: Yes
- Suitable for: HPLC, MS, SDS-PAGE, Functional Studies, Sandwich ELISA, Cell Culture
Description
-
Product name
Recombinant rat IL-17A protein (Active)
See all IL-17A proteins and peptides -
Biological activity
Fully biologically active determined by the dose dependent induction of IL-6 secretion in NIH-3T3 cells.
ED50 for this effect is ≤ 75.83 ng/ml, corresponding to specific activity of 1.32 X 104 units/mg.
-
Purity
>= 95 % SDS-PAGE.
=95% by HPLC -
Endotoxin level
<=0.005 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Full length protein -
Animal free
Yes -
Carrier free
Yes -
Nature
Recombinant -
-
Species
Rat -
Sequence
AVLIPQSSVCPNAEANNFLQNVKVNLKVINSLSSKASSRRPSDYLNRSTS PWTLSRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVL KREPEKCPFTFRVEKMLVGVGCTCVSSIVRHAS -
Predicted molecular weight
15 kDa -
Amino acids
18 to 150 -
Additional sequence information
N-terminal glycine
-
-
Description
Recombinant rat IL-17A protein
Specifications
Our Abpromise guarantee covers the use of ab282393 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
HPLC
Mass Spectrometry
SDS-PAGE
Functional Studies
Sandwich ELISA
Cell Culture
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at Room Temperature. Store at Room Temperature.
pH: 7.4
Constituents: 0.727% Dibasic monohydrogen potassium phosphate, 0.428% Monobasic dihydrogen potassium phosphate, 10.26% TrehaloseThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionStore lyophilized form at room temperature. Reconstitute in PBS, aliquot and store at -80°C for 12 months or +4°C for 1 week.Avoid repeated freeze-thaw. Lyophilized contents may appear as either a translucent film or a white powder. This variance does not affect the quality of the product.
General Info
-
Alternative names
- CTLA 8
- CTLA-8
- CTLA8
see all -
Function
Induces stromal cells to produce proinflammatory and hematopoietic cytokines. Enhances the surface expression of the intracellular adhesion molecule-1 (ICAM-1) in fibroblasts. -
Tissue specificity
Restricted to activated memory T-cells. -
Sequence similarities
Belongs to the IL-17 family. -
Post-translational
modificationsFound both in glycosylated and nonglycosylated forms. -
Cellular localization
Secreted. - Information by UniProt
Images
-
Functional analysis of ab282393.
Fully biologically active determined by the dose dependent induction of IL-6 secretion in NIH-3T3 cells.
ED50 for this effect is ≤ 75.83 ng/ml, corresponding to specific activity of 1.32 X 104 units/mg.
Cell based assay testing is performed on the first lot of protein only and is provided as a reference for protein activity; subsequent lots of protein must pass all biophysical quality control parameters that meet the same parameters as the first lot.
Lot: GR3393274-4
-
SDS-page analysis of ab282393.
-
Sandwich ELISA - Recombinant rat IL-17A protein standard curve.
Background subtracted standard curve using Rat IL-17A Antibody Pair - BSA and Azide free (ab242039) and Recombinant rat IL-17A protein (Active) (ab282393) in sandwich ELISA. The ELISA was performed using the components of the corresponding SimpleStep® kit, which uses the same antibody pair with a different formulation and format.
-
Mass determination by ESI-TOF.
Predicted MW is 15062.23 Da (+/- 10 Da by ESI-TOF). Observed MW is 15063.42.
-
HPLC analysis of ab282393.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab282393 has not yet been referenced specifically in any publications.