Description

  • Product name

    Recombinant Rat IL-1RA protein
    See all IL-1RA proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    purified by using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rat
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSHPAGKRPCKMQAFRIWDTNQKTFYLRN NQLIAGYLQGPNTKLEEKIDMVPIDFRNVFLGIHGGKLCLSCVKSGDDTK LQLEEVNITDLNKNKEEDKRFTFIRSETGPTTSFESLACPGWFLCTTLEA DHPVSLTNTPKEPCTVTKFYFQEDQ
    • Predicted molecular weight

      20 kDa including tags
    • Amino acids

      27 to 178
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Mature protein without signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab201897 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 0.02% DTT, 89% PBS, 10% Glycerol

General Info

  • Alternative names

    • DIRA
    • F630041P17Rik
    • ICIL 1RA
    • ICIL-1RA
    • ICIL1RA
    • IL-1ra
    • IL-1ra3
    • IL-1RN
    • IL1 inhibitor
    • IL1F3
    • IL1RA
    • IL1RA_HUMAN
    • IL1RN
    • IL1RN (IL1F3)
    • Interleukin 1 receptor antagonist
    • Interleukin-1 receptor antagonist protein
    • Intracellular IL 1 receptor antagonist type II
    • Intracellular interleukin 1 receptor antagonist (icIL 1ra)
    • IRAP
    • MGC10430
    • MVCD4
    • Type II interleukin 1 receptor antagonist
    see all
  • Function

    Inhibits the activity of interleukin-1 by binding to receptor IL1R1 and preventing its association with the coreceptor IL1RAP for signaling. Has no interleukin-1 like activity. Binds functional interleukin-1 receptor IL1R1 with greater affinity than decoy receptor IL1R2; however, the physiological relevance of the latter association is unsure.
  • Tissue specificity

    The intracellular form of IL1RN is predominantly expressed in epithelial cells.
  • Involvement in disease

    Microvascular complications of diabetes 4
    Interleukin 1 receptor antagonist deficiency
  • Cellular localization

    Cytoplasm and Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE of 3μg of ab201897.

References

ab201897 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201897.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up