Recombinant rat IL-3 protein (Active) (ab233668)
Key features and details
- Expression system: Escherichia coli
- Purity: >= 95% SDS-PAGE
- Endotoxin level: <= 1.000 Eu/µg
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE
Description
-
Product name
Recombinant rat IL-3 protein (Active)
See all IL-3 proteins and peptides -
Biological activity
NFS-60 cell proliferation: ED50 ≤ 10 ng/ml (≥ 1.0 x 104 units/mg).
-
Purity
>= 95 % SDS-PAGE. -
Endotoxin level
<=1.000 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Rat -
Sequence
MISDRGSDAHHLLRTLDCRTIALEILVKLPYPQVSGLNNSDDKANLRNST LRRVNLDEFLKSQEEFDSQDTTDIKSKLQKLKCCIPAAASDSVLPGVYNK DLDDFKKKLRFYVIHLKDLQPVSVSRPPQPTSSSDNFRPMTVEC -
Predicted molecular weight
16 kDa -
Amino acids
27 to 166 -
Additional sequence information
This product is the mature full length protein from aa 27 to 166. The signal peptide is not included.
-
Specifications
Our Abpromise guarantee covers the use of ab233668 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C.
Constituent: 0.1% Trifluoroacetic acid
Lyophilized from a sterile (0.2 micron) filtered aqueous solution.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconsitute with sterile water at 0.1 mg/ml. Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaws.
General Info
-
Alternative names
- Colony stimulating factor multiple
- Hematopoietic growth factor
- IL 3
see all -
Function
Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.
This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes. -
Tissue specificity
Activated T-cells, mast cells, natural killer cells. -
Sequence similarities
Belongs to the IL-3 family. -
Cellular localization
Secreted. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab233668 has not yet been referenced specifically in any publications.