Description

  • Product name

    Recombinant rat IL-7 protein
    See all IL-7 proteins and peptides
  • Biological activity

    The ED50 as determined by a cell proliferation assay using murine 2E8 cells is less than 2.0 ng/mL, corresponding to a specific activity of > 5.0 x 105 IU/mg.

  • Purity

    > 95 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rat
    • Sequence

      DCHIKDKDGKAFGSVLMISINQLDKMTGTDSDCPNNEPNFFKKHLCDDTK EAAFLNRAARKLRQFLKMNISEEFNDHLLRVSDGTQTLVNCTSKEEKTIK EQKKNDPCFLKRLLREIKTCWNKILKGSI
    • Predicted molecular weight

      15 kDa
    • Amino acids

      26 to 154
    • Additional sequence information

      This product is for the mature full length protein. The signal peptide is not included. A single non-glycosylated polypeptide chain.

Specifications

Our Abpromise guarantee covers the use of ab200296 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle. Store under desiccating conditions.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Briefly centrifuge prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL.

General Info

  • Alternative names

    • IL 7
    • IL-7
    • Il7
    • IL7_HUMAN
    • Interleukin 7
    • Interleukin-7
    • LP-1
    • Lymphopoietin 1
    see all
  • Function

    Hematopoietic growth factor capable of stimulating the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation.
  • Sequence similarities

    Belongs to the IL-7/IL-9 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab200296 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab200296.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up