Recombinant rat Interferon gamma protein (ab645)

Submit a review Q&A (1)References (3)

Key features and details

  • Expression system: Escherichia coli
  • Purity: > 98% SDS-PAGE
  • Active: Yes
  • Suitable for: Functional Studies, SDS-PAGE

Description

  • Product name

    Recombinant rat Interferon gamma protein
    See all Interferon gamma proteins and peptides

  • Biological activity

    The ED50 as determined by its ability to inhibit the proliferation of mouse WEHI-279 cells.

  • Purity

    > 98 % SDS-PAGE.
    By SDS-PAGE gel and HPLC analyses.

  • Expression system

    Escherichia coli

  • Accession

    P01581

  • Protein length

    Full length protein

  • Animal free

    No

  • Nature

    Recombinant

    • Species

      Rat

    • Sequence

      MQGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQI ISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFE VNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC

    • Predicted molecular weight

      16 kDa

Associated products

    Specifications

    Our Abpromise guarantee covers the use of ab645 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      Functional Studies

      SDS-PAGE

    • Form

      Lyophilized
    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA). Stable for 12 months at -20°C.

      This product is an active protein and may elicit a biological response in vivo, handle with caution.

    • Reconstitution
      Initially reconstitute in water to 0.1-1.0 mg/ml.

    General Info

    • Alternative names

      • IF 1
      • IFG
      • IFI
      • IFN gamma
      • IFN immune
      • IFN, immune
      • IFN-gamma
      • IFNG
      • IFNG_HUMAN
      • Immune interferon
      • Interferon gamma
      • Type II Interferon
      see all

    • Function

      Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.

    • Tissue specificity

      Released primarily from activated T lymphocytes.

    • Involvement in disease

      In Caucasians, genetic variation in IFNG is associated with the risk of aplastic anemia (AA) [MIM:609135]. AA is a rare disease in which the reduction of the circulating blood cells results from damage to the stem cell pool in bone marrow. In most patients, the stem cell lesion is caused by an autoimmune attack. T-lymphocytes, activated by an endogenous or exogenous, and most often unknown antigenic stimulus, secrete cytokines, including IFN-gamma, which would in turn be able to suppress hematopoiesis.

    • Sequence similarities

      Belongs to the type II (or gamma) interferon family.

    • Post-translational
      modifications

      Proteolytic processing produces C-terminal heterogeneity, with proteins ending alternatively at Gly-150, Met-157 or Gly-161.

    • Cellular localization

      Secreted.
    • Information by UniProt

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    References (3)

    Publishing research using ab645? Please let us know so that we can cite the reference in this datasheet.

    ab645 has been referenced in 3 publications.

    • Feng X  et al. Mycobacterium smegmatis Induces Neurite Outgrowth and Differentiation in an Autophagy-Independent Manner in PC12 and C17.2 Cells. Front Cell Infect Microbiol 8:201 (2018). PubMed: 29988402
    • Johnstone SA  et al. Comparison of human olfactory and skeletal MSCs using osteogenic nanotopography to demonstrate bone-specific bioactivity of the surfaces. Acta Biomater 13:266-76 (2015). PubMed: 25463488
    • Hall ME  et al. Rescue of cardiac leptin receptors in db/db mice prevents myocardial triglyceride accumulation. Am J Physiol Endocrinol Metab 307:E316-25 (2014). PubMed: 24939734

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    Question

    Will the rat IFN-g work in mouse cells and vice-versa, will mouse IFN-g work in rat cells?

    Read More
    Answer

    Dear Dr. Titheradge, Thank you for your patience. The rat IFN-gamma (ab645) was successfully tested in murine L929 cells - ab645 is cross reactive with mouse cells. We have not tested the mouse IFN-gamma in rat cells and do not know if ab9922 will stimulate rat cells. I hope this information helps.

    Read More

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com