For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    recombinant-rat-interferon-gamma-protein-ab645.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Immunology Innate Immunity Cytokines Interferons
Share by email

Recombinant rat Interferon gamma protein (ab645)

  • Datasheet
  • SDS
Submit a review Q&A (1)References (3)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Key features and details

  • Expression system: Escherichia coli
  • Purity: > 98% SDS-PAGE
  • Active: Yes
  • Suitable for: Functional Studies, SDS-PAGE

You may also be interested in

ELISA
Product image
Rat IFN gamma ELISA Kit (ab46107)

View more associated products

Description

  • Product name

    Recombinant rat Interferon gamma protein
    See all Interferon gamma proteins and peptides
  • Biological activity

    The ED50 as determined by its ability to inhibit the proliferation of mouse WEHI-279 cells.

  • Purity

    > 98 % SDS-PAGE.
    By SDS-PAGE gel and HPLC analyses.
  • Expression system

    Escherichia coli
  • Accession

    P01581
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rat
    • Sequence

      MQGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQI ISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFE VNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC
    • Predicted molecular weight

      16 kDa

Associated products

    Specifications

    Our Abpromise guarantee covers the use of ab645 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      Functional Studies

      SDS-PAGE

    • Form

      Lyophilized
    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA). Stable for 12 months at -20°C.

      This product is an active protein and may elicit a biological response in vivo, handle with caution.

    • Reconstitution
      Initially reconstitute in water to 0.1-1.0 mg/ml.

    General Info

    • Alternative names

      • IF 1
      • IFG
      • IFI
      • IFN gamma
      • IFN immune
      • IFN, immune
      • IFN-gamma
      • IFNG
      • IFNG_HUMAN
      • Immune interferon
      • Interferon gamma
      • Type II Interferon
      see all
    • Function

      Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.
    • Tissue specificity

      Released primarily from activated T lymphocytes.
    • Involvement in disease

      In Caucasians, genetic variation in IFNG is associated with the risk of aplastic anemia (AA) [MIM:609135]. AA is a rare disease in which the reduction of the circulating blood cells results from damage to the stem cell pool in bone marrow. In most patients, the stem cell lesion is caused by an autoimmune attack. T-lymphocytes, activated by an endogenous or exogenous, and most often unknown antigenic stimulus, secrete cytokines, including IFN-gamma, which would in turn be able to suppress hematopoiesis.
    • Sequence similarities

      Belongs to the type II (or gamma) interferon family.
    • Post-translational
      modifications

      Proteolytic processing produces C-terminal heterogeneity, with proteins ending alternatively at Gly-150, Met-157 or Gly-161.
    • Cellular localization

      Secreted.
    • Target information above from: UniProt accession P01579 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • SDS download

    • Datasheet download

      Download

    References (3)

    Publishing research using ab645? Please let us know so that we can cite the reference in this datasheet.

    ab645 has been referenced in 3 publications.

    • Feng X  et al. Mycobacterium smegmatis Induces Neurite Outgrowth and Differentiation in an Autophagy-Independent Manner in PC12 and C17.2 Cells. Front Cell Infect Microbiol 8:201 (2018). PubMed: 29988402
    • Johnstone SA  et al. Comparison of human olfactory and skeletal MSCs using osteogenic nanotopography to demonstrate bone-specific bioactivity of the surfaces. Acta Biomater 13:266-76 (2015). PubMed: 25463488
    • Hall ME  et al. Rescue of cardiac leptin receptors in db/db mice prevents myocardial triglyceride accumulation. Am J Physiol Endocrinol Metab 307:E316-25 (2014). PubMed: 24939734

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    Question

    Will the rat IFN-g work in mouse cells and vice-versa, will mouse IFN-g work in rat cells?

    Read More

    Abcam community

    Verified customer

    Asked on Aug 03 2006

    Answer

    Dear Dr. Titheradge, Thank you for your patience. The rat IFN-gamma (ab645) was successfully tested in murine L929 cells - ab645 is cross reactive with mouse cells. We have not tested the mouse IFN-gamma in rat cells and do not know if ab9922 will stimulate rat cells. I hope this information helps.

    Read More

    Abcam Scientific Support

    Answered on Aug 04 2006

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.