Recombinant rat Interferon gamma protein (ab645)
- Datasheet
- References (3)
- Protocols
Overview
-
Product nameRecombinant rat Interferon gamma protein
See all Interferon gamma proteins and peptides -
Protein lengthFull length protein
Description
-
NatureRecombinant
-
SourceEscherichia coli
-
Amino Acid Sequence
-
SpeciesRat
-
SequenceMQGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQI ISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFE VNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC
-
Molecular weight16 kDa
-
Specifications
Our Abpromise guarantee covers the use of ab645 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Endotoxin level< 0.100 Eu/µg
-
FormLyophilised
-
Additional notesThe ED50, determined by a cytopathic effect inhibition assay with murine L929 cells challenged with EMC virus is < 0.1 ng/ml, corresponding to a specific activity of > 1 x 107 units/mg.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA). Stable for 12 months at -20°C.
n/a
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with 10 mM sodium phosphate (pH 8.0) to a concentration of 0.1 - 1 mg/mL.
General Info
-
Alternative names
- IFG
- IFI
- IFN gamma
see all -
FunctionProduced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.
-
Tissue specificityReleased primarily from activated T lymphocytes.
-
Involvement in diseaseIn Caucasians, genetic variation in IFNG is associated with the risk of aplastic anemia (AA) [MIM:609135]. AA is a rare disease in which the reduction of the circulating blood cells results from damage to the stem cell pool in bone marrow. In most patients, the stem cell lesion is caused by an autoimmune attack. T-lymphocytes, activated by an endogenous or exogenous, and most often unknown antigenic stimulus, secrete cytokines, including IFN-gamma, which would in turn be able to suppress hematopoiesis.
-
Sequence similaritiesBelongs to the type II (or gamma) interferon family.
-
Post-translational
modificationsProteolytic processing produces C-terminal heterogeneity, with proteins ending alternatively at Gly-150, Met-157 or Gly-161. -
Cellular localizationSecreted.
- Information by UniProt
Datasheets and documents
References
This product has been referenced in:
- Feng X et al. Mycobacterium smegmatis Induces Neurite Outgrowth and Differentiation in an Autophagy-Independent Manner in PC12 and C17.2 Cells. Front Cell Infect Microbiol 8:201 (2018). Read more (PubMed: 29988402) »
- Johnstone SA et al. Comparison of human olfactory and skeletal MSCs using osteogenic nanotopography to demonstrate bone-specific bioactivity of the surfaces. Acta Biomater 13:266-76 (2015). Read more (PubMed: 25463488) »
