Recombinant rat IP10 protein (Active) (ab243765)
Key features and details
- Expression system: Escherichia coli
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Suitable for: Functional Studies, HPLC, SDS-PAGE
Description
-
Product name
Recombinant rat IP10 protein (Active)
See all IP10 proteins and peptides -
Biological activity
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human CXCR3 transfected HEK-293 cells is in a concentration range of 10-50 ng/ml.
-
Endotoxin level
< 1.000 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Rat -
Sequence
IPLARTVRCTCIDFHEQPLRPRAIGKLEIIPASLSCPHVEIIATMKKNNE KRCLNPESEAIKSLLKAVSQRRSKRAP -
Predicted molecular weight
9 kDa -
Amino acids
22 to 98 -
Additional sequence information
Full length mature chain without signal peptide.
-
Associated products
Specifications
Our Abpromise guarantee covers the use of ab243765 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
HPLC
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituent: PBS
0.2 µm filteredThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionWe recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at -20degC. Further dilutions should be made in appropriate buffered solutions.
General Info
-
Alternative names
- Interferon gamma induced factor MOB1, mouse, homolog of
- Interferon gamma induced protein 10
- 10 kDa interferon gamma induced protein
see all -
Function
Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3. -
Sequence similarities
Belongs to the intercrine alpha (chemokine CxC) family. -
Post-translational
modificationsCXCL10(1-73) is produced by proteolytic cleavage after secretion from keratinocytes. -
Cellular localization
Secreted. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab243765 has not yet been referenced specifically in any publications.