Recombinant rat ITK/EMT protein (ab196125)
Key features and details
- Expression system: Baculovirus infected Sf9 cells
- Purity: >= 58% SDS-PAGE
- Active: Yes
- Tags: GST tag N-Terminus
- Suitable for: Functional Studies, SDS-PAGE
Description
-
Product name
Recombinant rat ITK/EMT protein
See all ITK/EMT proteins and peptides -
Biological activity
Specific Activity: 1.0 pmol/min/μg
-
Purity
>= 58 % SDS-PAGE.
Affinity purified. -
Expression system
Baculovirus infected Sf9 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Rat -
Sequence
PVTAGLRYGKWVIQPSELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIQE GAMSEEDFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCLSD YLRSQRGLFAAETLLGMCLDVCEGMAYLEKACVIHRDLAARNCLVGENQV IKVSDFGMTRFVLDDQYTSSTGTKFPVKWASPEVFSFSRYSSKSDVWSFG VLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASPHVYQVMNHCW KEKPEDRPPFSRLLSQLAE -
Predicted molecular weight
57 kDa including tags -
Amino acids
352 to 620 -
Tags
GST tag N-Terminus
-
Specifications
Our Abpromise guarantee covers the use of ab196125 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Liquid -
Additional notes
Previously labelled as ITK.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.
pH: 8.00
Constituents: 0.4% Tris HCl, 0.58% Sodium chloride, 0.05% Tween, 0.05% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 10% Glycerol (glycerin, glycerine)This product is an active protein and may elicit a biological response in vivo, handle with caution.
General Info
-
Alternative names
- EMT
- Homolog of mouse T cell itk/tsk
- IL 2 inducible T cell kinase
see all -
Function
Plays a role in T-cell proliferation and differentiation. -
Tissue specificity
T-cell lines and natural killer cell lines. -
Involvement in disease
Defects in ITK are the cause of lymphoproliferative syndrome EBV-associated autosomal type 1 (LPSA1) [MIM:613011]. LPSA1 is a rare immunodeficiency characterized by extreme susceptibility to infection with Epstein-Barr virus (EBV). Inadequate immune response to EBV can have a fatal outcome. Clinical features include splenomegaly, lymphadenopathy, anemia, thrombocytopenia, pancytopenia, recurrent infections. There is an increased risk for lymphoma. -
Sequence similarities
Belongs to the protein kinase superfamily. Tyr protein kinase family. TEC subfamily.
Contains 1 Btk-type zinc finger.
Contains 1 PH domain.
Contains 1 protein kinase domain.
Contains 1 SH2 domain.
Contains 1 SH3 domain. -
Cellular localization
Cell membrane. Localizes to cell surface receptors in the plasma membrane after stimulation with respective receptors (TCR, CD28, CD2) in T-cells. - Information by UniProt
Images
-
10% SDS-PAGE analysis of ab196125 with Coomassie staining.
Lane 1: 20 µg Active rat ITK/EMT protein fragment (ab196125)
Lane 2: Protein marker -
Enzyme reaction was conducted at 30°C for 1 hour with 2 μM Tyr peptide in 50 mM HEPES pH 7.5, 0.01% BRIJ-35, 10 mM MgCl2, 1 mM EGTA. After the 1 hour incubation, diluted development reagent was added. Percentage phosphorylation was calculated based on the emission ratio of 445/520 nm after excitation.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab196125 has not yet been referenced specifically in any publications.