Description

  • Product name

    Recombinant rat ITK/EMT protein
    See all ITK/EMT proteins and peptides
  • Biological activity

    Specific Activity: 1.0 pmol/min/μg

  • Purity

    >= 58 % SDS-PAGE.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rat
    • Sequence

      PVTAGLRYGKWVIQPSELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIQE GAMSEEDFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCLSD YLRSQRGLFAAETLLGMCLDVCEGMAYLEKACVIHRDLAARNCLVGENQV IKVSDFGMTRFVLDDQYTSSTGTKFPVKWASPEVFSFSRYSSKSDVWSFG VLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASPHVYQVMNHCW KEKPEDRPPFSRLLSQLAE
    • Predicted molecular weight

      57 kDa including tags
    • Amino acids

      352 to 620
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab196125 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Previously labelled as ITK. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.4% Tris HCl, 0.58% Sodium chloride, 0.05% Tween, 0.05% DTT, 10% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • EMT
    • Homolog of mouse T cell itk/tsk
    • IL 2 inducible T cell kinase
    • IL2 inducible T cell kinase
    • Interleukin 2 inducible T cell kinase
    • Itk
    • ITK_HUMAN
    • Kinase EMT
    • LPFS1
    • LYK
    • MGC126257
    • MGC126258
    • PSCTK 2
    • PSCTK2
    • T cell specific kinase
    • T-cell-specific kinase
    • TSK
    • Tyrosine protein kinase
    • Tyrosine protein kinase ITK/TSK
    • Tyrosine protein kinase Lyk
    • Tyrosine-protein kinase ITK/TSK
    • Tyrosine-protein kinase Lyk
    see all
  • Function

    Plays a role in T-cell proliferation and differentiation.
  • Tissue specificity

    T-cell lines and natural killer cell lines.
  • Involvement in disease

    Defects in ITK are the cause of lymphoproliferative syndrome EBV-associated autosomal type 1 (LPSA1) [MIM:613011]. LPSA1 is a rare immunodeficiency characterized by extreme susceptibility to infection with Epstein-Barr virus (EBV). Inadequate immune response to EBV can have a fatal outcome. Clinical features include splenomegaly, lymphadenopathy, anemia, thrombocytopenia, pancytopenia, recurrent infections. There is an increased risk for lymphoma.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. TEC subfamily.
    Contains 1 Btk-type zinc finger.
    Contains 1 PH domain.
    Contains 1 protein kinase domain.
    Contains 1 SH2 domain.
    Contains 1 SH3 domain.
  • Cellular localization

    Cell membrane. Localizes to cell surface receptors in the plasma membrane after stimulation with respective receptors (TCR, CD28, CD2) in T-cells.
  • Information by UniProt

Images

  • 10% SDS-PAGE analysis of ab196125 with Coomassie staining.

    Lane 1: 20 µg Active rat ITK/EMT protein fragment (ab196125)
    Lane 2: Protein marker

  • Enzyme reaction was conducted at 30°C for 1 hour with 2 μM Tyr peptide in 50 mM HEPES pH 7.5, 0.01% BRIJ-35, 10 mM MgCl2, 1 mM EGTA. After the 1 hour incubation, diluted development reagent was added. Percentage phosphorylation was calculated based on the emission ratio of 445/520 nm after excitation.

References

ab196125 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196125.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up