Description

  • Product name

    Recombinant Rat LAG-3 protein
    See all LAG-3 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rat
    • Sequence

      GPGKELSVVWAQEGAPVHLPCSLEFPHLDPNFLRRGWVTWQHRPDSDQPA SIPALDLLQGMPSTRRHPPHRYTVLSVAPGGLRSGRQPLLSHVQLEKRGP QRGDFSLWLRPATRKDAGEYHAFVRLPDRDFSCSLRLRVGQASMIASPPG TLKPSDWVILNCSFSRPDRPVSVHWFQGQSRVPVHNSPRHYLAESFLLLP QVSPLDSGTWGCVLTYRDGFNVSITYNLKVQGLEPVAPLTVYAAEGSRVE LPCHLPPVVGTPSLLIAKWTPPGGGPELPVTGKSGNFTLQLENVGRAQAG TYTCSIHLQGRQLSAAVTLAVITVTPKSFGLPGSPQKLLCEVVPASGEGR FVWRPLSDLSRSSLGPVLELQEAKLLAEQWQCQLYEGQKLLGATVYTAES SSGAWSAKRISGDLKGGHL
    • Predicted molecular weight

      48 kDa including tags
    • Amino acids

      24 to 442
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain (NP_997678).

Specifications

Our Abpromise guarantee covers the use of ab207119 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    This product was previously labelled as Lymphocyte Activation Gene 3.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

  • Reconstitution
    Reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • CD223
    • CD223 antigen
    • FDC protein
    • LAG-3
    • Lag3
    • LAG3_HUMAN
    • Lymphocyte activating 3
    • Lymphocyte activation gene 3
    • Lymphocyte activation gene 3 protein
    • Protein FDC
    see all
  • Function

    Involved in lymphocyte activation. Binds to HLA class-II antigens.
  • Tissue specificity

    On cell surface of activated NK and T-lymphocytes.
  • Sequence similarities

    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • DTT-reduced SDS-PAGE analysis of ab207119 stained overnight with Coomassie Blue.

    DTT-reduced protein migrates as 55 kDa in SDS-PAGE due to glycosylation.

References

ab207119 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab207119.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up