Recombinant Rat Lipocalin-2 / NGAL protein (ab188053)
Key features and details
- Expression system: Escherichia coli
- Suitable for: ELISA
Description
-
Product name
Recombinant Rat Lipocalin-2 / NGAL protein
See all Lipocalin-2 / NGAL proteins and peptides -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Rat -
Sequence
MGLGVLCLALVLLGVLQSQAQDSTQNLIPAPPLISVPLQPGFWTERFQGR WFVVGLAGNAVQKERQSRFTMYSTIYELQEDNSYNVTSILVRGQGCRYWI RTFVPSSRPGQFTLGNIHSYPQIQSYDVQVADTDYDQFAMVFFQKTSENK QYFKVTLYGRTKGLSDELKERFVSFAKSLGLKDNNIVFSVPTDQCIDN -
Predicted molecular weight
22 kDa -
Amino acids
1 to 198
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab188053 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
ELISA
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C.
pH: 7.40
Constituents: 0.81% Sodium chloride, 0.5% BSA, 0.5% Tween, 0.0016% Phenol red, 98% PBS, 0.1% Proclin 950
General Info
-
Alternative names
- 24p3
- 25 kDa alpha 2 microglobulin related subunit of MMP9
- 25 kDa alpha-2-microglobulin-related subunit of MMP-9
see all -
Function
Iron-trafficking protein involved in multiple processes such as apoptosis, innate immunity and renal development. Binds iron through association with 2,5-dihydroxybenzoic acid (2,5-DHBA), a siderophore that shares structural similarities with bacterial enterobactin, and delivers or removes iron from the cell, depending on the context. Iron-bound form (holo-24p3) is internalized following binding to the SLC22A17 (24p3R) receptor, leading to release of iron and subsequent increase of intracellular iron concentration. In contrast, association of the iron-free form (apo-24p3) with the SLC22A17 (24p3R) receptor is followed by association with an intracellular siderophore, iron chelation and iron transfer to the extracellular medium, thereby reducing intracellular iron concentration. Involved in apoptosis due to interleukin-3 (IL3) deprivation: iron-loaded form increases intracellular iron concentration without promoting apoptosis, while iron-free form decreases intracellular iron levels, inducing expression of the proapoptotic protein BCL2L11/BIM, resulting in apoptosis. Involved in innate immunity, possibly by sequestrating iron, leading to limit bacterial growth. -
Tissue specificity
Expressed in bone marrow and in tissues that are prone to exposure to microorganism. High expression is found in bone marrow as well as in uterus, prostate, salivary gland, stomach, appendix, colon, trachea and lung. Not found in the small intestine or peripheral blood leukocytes. -
Sequence similarities
Belongs to the calycin superfamily. Lipocalin family. -
Cellular localization
Secreted. Upon binding to the SLC22A17 (24p3R) receptor, it is internalized. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab188053 has not yet been referenced specifically in any publications.