Description

  • Product name

    Recombinant Rat Lipocalin-2 / NGAL protein
    See all Lipocalin-2 / NGAL proteins and peptides
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rat
    • Sequence

      MGLGVLCLALVLLGVLQSQAQDSTQNLIPAPPLISVPLQPGFWTERFQGR WFVVGLAGNAVQKERQSRFTMYSTIYELQEDNSYNVTSILVRGQGCRYWI RTFVPSSRPGQFTLGNIHSYPQIQSYDVQVADTDYDQFAMVFFQKTSENK QYFKVTLYGRTKGLSDELKERFVSFAKSLGLKDNNIVFSVPTDQCIDN
    • Predicted molecular weight

      22 kDa
    • Amino acids

      1 to 198

Associated products

Specifications

Our Abpromise guarantee covers the use of ab188053 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C.

    pH: 7.4
    Preservative: 0.1% Proclin
    Constituents: 0.81% Sodium chloride, 0.5% BSA, 0.5% Tween, 0.0016% Phenol red, 98% PBS

General Info

  • Alternative names

    • 24p3
    • 25 kDa alpha 2 microglobulin related subunit of MMP9
    • 25 kDa alpha-2-microglobulin-related subunit of MMP-9
    • Alpha 2 microglobulin related protein
    • HGNC:6526
    • HNL
    • Lcn 2
    • Lcn2
    • Lipocalin-2
    • Migration stimulating factor inhibitor
    • MSFI
    • Neutrophil gelatinase associated lipocalin
    • Neutrophil gelatinase associated lipocalin precursor
    • Neutrophil gelatinase-associated lipocalin
    • NGAL
    • NGAL_HUMAN
    • Oncogene 24p3
    • Oncogenic lipocalin 24p3
    • p25
    • Siderocalin
    • siderocalin LCN2
    • SV40 induced 24P3 protein
    • Uterocalin
    see all
  • Function

    Iron-trafficking protein involved in multiple processes such as apoptosis, innate immunity and renal development. Binds iron through association with 2,5-dihydroxybenzoic acid (2,5-DHBA), a siderophore that shares structural similarities with bacterial enterobactin, and delivers or removes iron from the cell, depending on the context. Iron-bound form (holo-24p3) is internalized following binding to the SLC22A17 (24p3R) receptor, leading to release of iron and subsequent increase of intracellular iron concentration. In contrast, association of the iron-free form (apo-24p3) with the SLC22A17 (24p3R) receptor is followed by association with an intracellular siderophore, iron chelation and iron transfer to the extracellular medium, thereby reducing intracellular iron concentration. Involved in apoptosis due to interleukin-3 (IL3) deprivation: iron-loaded form increases intracellular iron concentration without promoting apoptosis, while iron-free form decreases intracellular iron levels, inducing expression of the proapoptotic protein BCL2L11/BIM, resulting in apoptosis. Involved in innate immunity, possibly by sequestrating iron, leading to limit bacterial growth.
  • Tissue specificity

    Expressed in bone marrow and in tissues that are prone to exposure to microorganism. High expression is found in bone marrow as well as in uterus, prostate, salivary gland, stomach, appendix, colon, trachea and lung. Not found in the small intestine or peripheral blood leukocytes.
  • Sequence similarities

    Belongs to the calycin superfamily. Lipocalin family.
  • Cellular localization

    Secreted. Upon binding to the SLC22A17 (24p3R) receptor, it is internalized.
  • Information by UniProt

Images

  • ELISA calibration curve using ab188053 as a standard

References

ab188053 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188053.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up