Description

  • Product name

    Recombinant Rat Mast Cell Tryptase protein (Tagged)
    See all Mast Cell Tryptase proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rat
    • Sequence

      IVGGQEASGNKWPWQVSLRVNDTYWMHFCGGSLIHPQWVLTAAHCVGPNK ADPNKLRVQLRKQYLYYHDHLLTVSQIISHPDFYIAQDGADIALLKLTNP VNITSNVHTVSLPPASETFPSGTLCWVTGWGNINNDVSLPPPFPLEEVQV PIVENRLCDLKYHKGLNTGDNVHIVRDDMLCAGNEGHDSCQGDSGGPLVC KVEDTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIYRYVPKYF
    • Predicted molecular weight

      47 kDa including tags
    • Amino acids

      29 to 273
    • Additional sequence information

      Full length mature chain without the signal peptide or propeptide. N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged.

Specifications

Our Abpromise guarantee covers the use of ab237003 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • alpha II
    • Lung tryptase
    • Mast cell alpha II tryptase
    • Mast cell beta I tryptase
    • Mast cell protease 7
    • Mast cell protease II
    • MCP 7
    • Pituitary tryptase
    • Skin tryptase
    • TPS 1
    • TPS1
    • TPS2
    • TPSAB1
    • TPSAB1 protein
    • TPSB1
    • Tryptase 1
    • Tryptase alpha 1
    • tryptase alpha I included
    • Tryptase alpha II
    • tryptase alpha II included
    • tryptase alpha included
    • tryptase alpha/beta 1
    • Tryptase beta 1
    • tryptase beta I included
    • Tryptase I
    • tryptase I included
    • Tryptase III
    • Tryptase skin
    see all
  • Relevance

    Mast cells contain a number of preformed chemical mediators such as histamine, chymase, carboxypeptidase and proteolytic tryptase. Human Mast Cell Tryptase is considered to be an important marker of mast cell activation as well as an important mediator of inflammation.
  • Cellular localization

    Secreted. Note: released from the secretory granules upon mast cell activation.

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel of ab237003.

References

ab237003 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237003.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up