Description

  • Product name

    Recombinant rat MCP3 protein
    See all MCP3 proteins and peptides
  • Biological activity

    Fully biologically active when compared to standard.

    The biological activity determined by a chemotaxis bioassay using Human monocytes is in a concentration range of 10-100 ng/ml.

  • Purity

    > 95 % SDS-PAGE.
    >95% by HPLC analysis.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rat
    • Sequence

      QPDGTNSSTCCYVKKQKIPKRNLKSYRKITSSRCPWEAVIFKTKKGMEVC AEAHQKWVEEAIAYLDMKTSTPKP
    • Predicted molecular weight

      9 kDa
    • Amino acids

      24 to 97
    • Additional sequence information

      Single non-glycosylated polypeptide chain. This product is the mature full length protein from aa 24 to 97. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab201410 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    Lyophilised from a 0.2µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Briefly centrifuge the vial prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at -20°C to -70°C. Further dilutions should be made in appropriate buffered solutions.

General Info

  • Alternative names

    • C-C motif chemokine 7
    • Ccl7
    • CCL7_HUMAN
    • Chemokine CC motif ligand 7
    • FIC
    • MARC
    • MCP-3
    • Monocyte chemoattractant protein 3
    • Monocyte chemotactic protein 3
    • NC28
    • RP23-350G1.4
    • SCYA6
    • SCYA7
    • Small-inducible cytokine A7
    see all
  • Function

    Chemotactic factor that attracts monocytes and eosinophils, but not neutrophils. Augments monocyte anti-tumor activity. Also induces the release of gelatinase B. This protein can bind heparin. Binds to CCR1, CCR2 and CCR3.
  • Sequence similarities

    Belongs to the intercrine beta (chemokine CC) family.
  • Post-translational
    modifications

    O-glycosylated.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab201410 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201410.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up