Overview

Description

  • Nature

    Recombinant
  • Source

    Yeast
  • Amino Acid Sequence
    • Accession
    • Species

      Rat
    • Sequence

      MPEASSPRRTPQNVPYQDLPHLVNADGQYLFCRYWKPSGTPKALIFVSHG AGEHCGRYDELAQMLKRLDMLVFAHDHVGHGQSEGERMVVSDFQVFVRDL LQHVNTVQKDYPEVPVFLLGHSMGGAISILAAAERPTHFSGMILISPLIL ANPESASTLKVLAAKLLNFVLPNISLGRIDSSVLSRNKSEVDLYNSDPLI CHAGVKVCFGIQLLNAVSRVERAMPRLTLPFLLLQGSADRLCDSKGAYLL MESSPSQDKTLKMYEGAYHVLHKELPEVTNSVLHEINTWVSHRIAVAGAR CLP
    • Molecular weight

      36 kDa including tags
    • Amino acids

      1 to 303
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab226888 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as Monoacylglycerol Lipase

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • EC 3.1.1.23
    • HU K5
    • HU-K5
    • HUK5
    • Lysophospholipase homolog
    • Lysophospholipase like
    • Lysophospholipase-like
    • MAGL
    • MGL
    • MGLL
    • MGLL_HUMAN
    • Monoacylglycerol lipase
    • Monoglyceride lipase
    see all
  • Function

    Converts monoacylglycerides to free fatty acids and glycerol. Hydrolyzes the endocannabinoid 2-arachidonoylglycerol, and thereby contributes to the regulation of endocannabinoid signaling, nociperception and perception of pain (By similarity). Regulates the levels of fatty acids that serve as signaling molecules and promote cancer cell migration, invasion and tumor growth.
  • Tissue specificity

    Detected in adipose tissue, lung, liver, kidney, brain and heart.
  • Pathway

    Glycerolipid metabolism; triacylglycerol degradation.
  • Sequence similarities

    Belongs to the AB hydrolase superfamily. Monoacylglycerol lipase family.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab226888 with 5% enrichment gel and 15% separation gel.

References

ab226888 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab226888.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up