Description

  • Product name

    Recombinant Rat MRP8 protein (His tag)
    See all MRP8 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rat
    • Sequence

      ATELEKALSNVIEVYHNYSGIKGNHHALYRDDFRKMVTTECPQFVQNKNT ESLFKELDVNSDNAINFEEFLVLVIRVGVAAHKDSHKE
    • Predicted molecular weight

      14 kDa including tags
    • Amino acids

      2 to 89
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab226448 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • 60B8Ag
    • AI323541
    • B8Ag
    • BEE11
    • CAGA
    • Calgranulin-A
    • Calprotectin L1L subunit
    • Calprotectin, included
    • CFAG
    • CGLA
    • Chemotactic cytokine CP-10
    • CP-10
    • Cystic fibrosis antigen
    • L1Ag
    • Leukocyte L1 complex light chain
    • MA387
    • MIF
    • Migration inhibitory factor-related protein 8
    • MRP-8
    • Myeloid-related protein 8
    • Neutrophil cytosolic 7 kDa protein
    • NIF
    • p8
    • Pro-inflammatory S100 cytokine
    • Protein S100-A8
    • S100 calcium binding protein A8
    • S100 calcium binding protein A8 (calgranulin A)
    • S100 calcium-binding protein A8
    • S100A8
    • S100A8/S100A9 complex, included
    • S10A8_HUMAN
    • Urinary stone protein band A
    see all
  • Function

    Calcium-binding protein. Has antimicrobial activity towards bacteria and fungi. Important for resistance to invasion by pathogenic bacteria. Up-regulates transcription of genes that are under the control of NF-kappa-B. Plays a role in the development of endotoxic shock in response to bacterial lipopolysaccharide (LPS) (By similarity). Promotes tubulin polymerization. Promotes phagocyte migration and infiltration of granulocytes at sites of wounding. Plays a role as pro-inflammatory mediator in acute and chronic inflammation and up-regulates the release of IL8 and cell-surface expression of ICAM1. Extracellular calprotectin binds to target cells and promotes apoptosis. Antimicrobial and proapoptotic activity is inhibited by zinc ions.
  • Tissue specificity

    Expressed by macrophages in chronic inflammations. Also expressed in epithelial cells constitutively or induced during dermatoses.
  • Sequence similarities

    Belongs to the S-100 family.
    Contains 2 EF-hand domains.
  • Cellular localization

    Secreted. Cytoplasm. Cytoplasm > cytoskeleton. Cell membrane. Associates with tubulin filaments in activated monocytes. Targeted to the cell surface upon calcium influx. Released from blood leukocytes upon exposure to CSF2/GM-CSF, bacterial lipopolysaccharide (LPS) and during inflammatory processes. Serum levels are high in patients suffering from chronic inflammation.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

References

ab226448 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab226448.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up