Description

  • Product name

    Recombinant Rat Neuropilin 1 protein (His tag)
    See all Neuropilin 1 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab219291 was purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rat
    • Sequence

      FRSDKCGGTIKIENPGYLTSPGYPHSYHPSEKCEWLIQAPEPYQRIMINF NPHFDLEDRDCKYDYVEVIDGENEGGRLWGKFCGKIAPSPVVSSGPFLFI KFVSDYETHGAGFSIRYEIFKRGPECSQNYTAPTGVIKSPGFPEKYPNSL ECTYIIFAPKMSEIILEFESFDLEQDSNPPGGVFCRYDRLEIWDGFPEVG PHIGRYCGQKTPGRIRSSSGILSMVFYTDSAIAKEGFSANYSVLQSSISE DFKCMEALGMESGEIHSDQITASSQYGTNWSVERSRLNYPENGWTPGEDS YREWIQVDLGLLRFVTAVGTQGAISKETKKKYYVKTYRVDISSNGEDWIT LKEGNKAIIFQGNTNPTDVVFGVFPKPLITRFVRIKPASWETGISMRFEV YGCKITDYPCSGMLGMVSGLISDSQITASNQGDRNWMPENIRLVTSRTGW ALPPSPHPYINEWLQVDLGDEKIVRGVIIQGGKHRENKVFMRKFKIAYSN NGSDWKMIMDDSKRKAKSFEGNNNYDTPELRAFTPLSTRFIRIYPERATH SGLGLRMELLGCEVEVPTAGPTTPNGNPVDECDDDQANCHSGTGDDFQLT GGTTVLATEKPTIIDSTIQSEFPTYGFNCEFGWGSHKTFCHWEHDSHAQL RWRVLTSKTGPIQDHTGDGNFIYSQADENQKGKVARLVSPVVYSQSSAHC MTFWYHMSGSHVGTLRVKLHYQKPEEYDQLVWMVVGHQGDHWKEGRVLLH KSLKLYQVIFEGEIGKGNLGGIAVDDISINNHIPQEDCAKPTDLDKKNTE IKIDETGSTPGYEEGKGDKNISRKPGNVLKTLDPLEHHHHHH
    • Predicted molecular weight

      95 kDa including tags
    • Amino acids

      22 to 855
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain (NP_659566).

Specifications

Our Abpromise guarantee covers the use of ab219291 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 90% PBS, 10% Glycerol

General Info

  • Alternative names

    • A5 protein
    • BDCA4
    • BLOOD DENDRITIC CELL ANTIGEN 4
    • CD304
    • Neuropilin-1
    • Neuropilin1
    • NP1
    • NPN1
    • NRP
    • NRP 1
    • NRP1
    • NRP1_HUMAN
    • transmembrane receptor
    • Vascular endothelial cell growth factor 165 receptor
    • VEGF165R
    see all
  • Function

    The membrane-bound isoform 1 is a receptor involved in the development of the cardiovascular system, in angiogenesis, in the formation of certain neuronal circuits and in organogenesis outside the nervous system. It mediates the chemorepulsant activity of semaphorins. It binds to semaphorin 3A, The PLGF-2 isoform of PGF, The VEGF-165 isoform of VEGF and VEGF-B. Coexpression with KDR results in increased VEGF-165 binding to KDR as well as increased chemotaxis. It may regulate VEGF-induced angiogenesis.
    The soluble isoform 2 binds VEGF-165 and appears to inhibit its binding to cells. It may also induce apoptosis by sequestering VEGF-165. May bind as well various members of the semaphorin family. Its expression has an averse effect on blood vessel number and integrity.
  • Tissue specificity

    The expression of isoforms 1 and 2 does not seem to overlap. Isoform 1 is expressed by the blood vessels of different tissues. In the developing embryo it is found predominantly in the nervous system. In adult tissues, it is highly expressed in heart and placenta; moderately in lung, liver, skeletal muscle, kidney and pancreas; and low in adult brain. Isoform 2 is found in liver hepatocytes, kidney distal and proximal tubules.
  • Sequence similarities

    Belongs to the neuropilin family.
    Contains 2 CUB domains.
    Contains 2 F5/8 type C domains.
    Contains 1 MAM domain.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 μg ab219291.

    Molecular weight: 100-150 kDa (SDS-PAGE under reducing conditions).

References

ab219291 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219291.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up