Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Rat
    • Sequence

      VPIDVDKTKVHNVEPVESARIEPPDTGLYYDEYLKQVIEVLETDPHFREK LQKADIEEIRSGRLSQELDLVSHKVRTRLDEL
    • Molecular weight

      8 kDa
    • Amino acids

      25 to 106

Specifications

Our Abpromise guarantee covers the use of ab157014 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 0.100 Eu/µg
  • Purity

    > 95 % SDS-PAGE.

  • Form

    Lyophilised
  • Additional notes

    Previously labelled as Nucleobindin 2. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

    Constituent: 99% PBS

  • Reconstitution
    Reconstitute with 100µl sterile water. Further dilutions should be made with medium containing 0.2% bovine serum albumin. 0.1mg/ml after reconstitution.

General Info

  • Alternative names

    • DNA binding protein NEFA
    • DNA-binding protein NEFA
    • Gastric cancer antigen Zg4
    • HEL S 109
    • NEFA
    • Nefastin 1
    • Nefastin-1
    • Nefastin1
    • Nucb2
    • NUCB2_HUMAN
    • Nucleobindin 2
    • Nucleobindin-2
    • Nucleobinding 2
    • Prepronefastin
    • Prepronesfatin
    see all
  • Function

    Calcium-binding protein. May have a role in calcium homeostasis.
  • Tissue specificity

    Predominantly expressed in spleen, testis and normal stomach.
  • Sequence similarities

    Belongs to the nucleobindin family.
    Contains 2 EF-hand domains.
  • Cellular localization

    Membrane. Cytoplasm. Secreted.
  • Information by UniProt

References

ab157014 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157014.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up