Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Rat
    • Sequence

      YLNNGLGAPAPYPDPLEPHREVCELNPNCDELADHIGFQDAYKRIYGTTV
    • Molecular weight

      33 kDa including tags
    • Amino acids

      50 to 99
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 50 to 99. The signal peptide and propeptide are not included.

Specifications

Our Abpromise guarantee covers the use of ab226311 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • BGLAP
    • BGP
    • Bone gamma carboxyglutamate (gla) protein
    • Bone gamma carboxyglutamate gla protein osteocalcin
    • Bone gamma carboxyglutamate protein
    • Bone Gla protein
    • Gamma carboxyglutamic acid containing protein
    • Gamma-carboxyglutamic acid-containing protein
    • OC
    • OCN
    • OSTCN_HUMAN
    • Osteocalcin
    • OTTHUMP00000016586
    • PMF1
    see all
  • Function

    Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium.
  • Sequence similarities

    Belongs to the osteocalcin/matrix Gla protein family.
    Contains 1 Gla (gamma-carboxy-glutamate) domain.
  • Post-translational
    modifications

    Gamma-carboxyglutamate residues are formed by vitamin K dependent carboxylation. These residues are essential for the binding of calcium.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab226311 with 5% enrichment gel and 15% separation gel.

References

ab226311 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab226311.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up