Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Rat
    • Sequence

      SPLPESHTAQQATNFGVKVFQHVVQASKDRNVVFSPYGVSSVLAMLQLTT AGKTRQQIQDAMGFNISERGTAPALRKLSKELMGSWNKNEISTADAIFVQ RDLELVQGFMPHFFKLFRTTVKQVDFSEVERARFIINDWVERHTKGMISD LLAKGAVNELTRLVLVNALYFNGQWKTPFLEASTHQRLFHKSDGSTISVP MMAQNNKFNYTEFTTPDGHEYDILELPYHGETLSMFIAAPFEKDVPLSAI TNILDAELIRQWKSNMTRLPRLLILPKFSLETEVDLRGPLEKLGMTDIFS STQADFTSLSDQEQLSVAQALQKVKIEVNESGTVASSSTAILVSARMAPT EMVLDRSFLFVVRHNPTETILFMGQLMEP
    • Molecular weight

      43 kDa including tags
    • Amino acids

      24 to 402
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab170082 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    ab170082 is >60 percent active as determined by SDS PAGE.
  • Applications

    SDS-PAGE

    Western blot

    Functional Studies

  • Purity

    > 95 % SDS-PAGE.
    The His tag allows for the immobilization of functionally active PAI1 onto surfaces such as metal chelate microtiter plates or Ni+2 resins. The purification conditions are gentle and result in an active fraction >99 percent pure and >60 percent active as determined by SDS PAGE.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 5.00
    Constituents: 0.41% Sodium acetate, 0.03% EDTA, 0.58% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Clade E
    • Endothelial plasminogen activator inhibitor
    • Nexin
    • Nexin plasminogen activator inhibitor type 1
    • PAI
    • PAI 1
    • PAI-1
    • PAI1_HUMAN
    • PLANH1
    • Plasminogen activator inhibitor 1
    • Plasminogen activator inhibitor type 1
    • Serine (or cysteine) proteinase inhibitor
    • Serine (or cysteine) proteinase inhibitor clade E (nexin plasminogen activator inhibitor type 1) member 1
    • Serine proteinase inhibitor clade E member 1
    • serpin
    • Serpin E1
    • Serpin peptidase inhibitor clade E
    • Serpin peptidase inhibitor clade E (nexin plasminogen activator inhibitor type 1) member 1
    • Serpine 1
    • SERPINE1
    see all
  • Function

    This inhibitor acts as 'bait' for tissue plasminogen activator, urokinase, and protein C. Its rapid interaction with TPA may function as a major control point in the regulation of fibrinolysis.
  • Tissue specificity

    Found in plasma and platelets and in endothelial, hepatoma and fibrosarcoma cells.
  • Involvement in disease

    Defects in SERPINE1 are the cause of plasminogen activator inhibitor-1 deficiency (PAI-1D) [MIM:613329]. It is a hematologic disorder characterized by increased bleeding after trauma, injury, or surgery. Affected females have menorrhagia. The bleeding defect is due to increased fibrinolysis of fibrin blood clots due to deficiency of plasminogen activator inhibitor-1, which inhibits tissue and urinary activators of plasminogen.
    Note=High concentrations of SERPINE1 seem to contribute to the development of venous but not arterial occlusions.
  • Sequence similarities

    Belongs to the serpin family.
  • Post-translational
    modifications

    Inactivated by proteolytic attack of the urokinase-type (u-PA) and the tissue-type (TPA), cleaving the 369-Arg-
    -Met-370 bond.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab170082.

    Lane 1: 3µg ab170082 Reduced
    Lane 2: Rat PAI1 (3µg) + Urokinase (15µg) Reduced

  • Anti His tag Western Blot analysis of ab170082.

    Lane 1: 0.5µg ab170082 Reduced
    Lane 2: Rat PAI1 (0.5µg) + Urokinase (7.5µg) Reduced

References

ab170082 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab170082.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up