Description

  • Product name

    Recombinant Rat PCSK9 protein
    See all PCSK9 proteins and peptides
  • Purity

    > 97 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rat
    • Sequence

      QDEDGDYEELMLALPSQEDSLVDEASHVATATFRRCSKEAWRLPGTYVVV LMEETQRLQV EQTAHRLQTWAARRGYVIKVLHVFYDLFPGFLVKMSSD LLGLALKLPHVEYIEEDSLVFAQSIPWNLERIIPAWQQTEEDSSPDGSSQ VEVYLLDTSIQSGHREIEGRVTITDFNSVPEED GTRFHRQASKCDSHG THLAGVVSGRDAGVAKGTSLHSLRVLNCQGKGTVSGTLIGLEFIR KSQ LIQPSGPLVVLLPLAGGYSRILNTACQRLARTGVVLVAAAGNFRDDACLY SPASAPE VITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGKDIIGASS DCSTCYMSQSGTSQAAAHV AGIVAMMLNRDPALTLAELRQRLILFSTK DVINMAWFPEDQRVLTPNRVATLPPSTQETG GQLLCRTVWSAHSGPTR TATATARCAPEEELLSCSSFSRSGRRRGDRIEAIGGQQVCKAL NAFGG EGVYAVARCCLLPRVNCSIHNTPAARAGPQTPVHCHQKDHVLTGCSFHWE VENLR AQQQPLLRSRHQPGQCVGHQEASVHASCCHAPGLECKIKEHGI AGPAEQVTVACEAGWTL TGCNVLPGASLPLGAYSVDNVCVARIRDAGR ADRTSEEATVAAAICCRSRPSAKASWVHQ
    • Predicted molecular weight

      73 kDa including tags
    • Amino acids

      31 to 691
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Mature form including propeptide. The signal peptide is not included. (NP_954862).

Specifications

Our Abpromise guarantee covers the use of ab201424 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in 50 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • Convertase subtilisin/kexin type 9 preproprotein
    • FH3
    • HCHOLA3
    • Hypercholesterolemia autosomal dominant 3
    • LDLCQ1
    • NARC 1
    • NARC-1
    • NARC1
    • Neural apoptosis regulated convertase 1
    • Neural apoptosis-regulated convertase 1
    • PC 9
    • PC9
    • PCSK 9
    • PCSK9
    • PCSK9_HUMAN
    • Proprotein convertase 9
    • Proprotein convertase PC9
    • Proprotein convertase subtilisin/kexin type 9
    • PSEC0052
    • Subtilisin/kexin like protease PC9
    • Subtilisin/kexin-like protease PC9
    see all
  • Function

    May be implicated in the differentiation of cortical neurons and may play a role in cholesterol homeostasis.
  • Tissue specificity

    Expressed in neuro-epithelioma, colon carcinoma, hepatic and pancreatic cell lines, and in Schwann cells.
  • Involvement in disease

    Defects in PCSK9 are the cause of familial hypercholesterolemia 3 (FH3) [MIM:603776]. FH3 inheritance is autosomal dominant.
  • Sequence similarities

    Belongs to the peptidase S8 family.
    Contains 1 peptidase S8 domain.
  • Post-translational
    modifications

    The soluble zymogen undergoes autocatalytic intramolecular processing in the endoplasmic reticulum, resulting in the cleavage of its propeptide that remains associated with the secreted enzyme.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • The purity of ab201424 was determined by DTT-reduced (+) SDS-PAGE and staining overnight with Coomassie Blue. DTT-reduced Protein migrates as 22 and 66 kDa in SDS-PAGE due to glycosylation.

References

ab201424 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201424.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up