Description

  • Product name

    Recombinant Rat PD1 protein (Fc Chimera)
    See all PD1 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rat
    • Sequence

      LEVLNKPWRPLTFSPTWLTVSEGANATFTCSFSNWSEDLKLNWYRLSPSN QTEKQAAFCNGYSQPVRDARFQIVQLPNGHDFHMNILDARRNDSGIYLCG AISLPPKAQIKESPGAELVVTERILETPTRYPRPSPKPEGQFQ
    • Predicted molecular weight

      43 kDa including tags
    • Amino acids

      25 to 167
    • Additional sequence information

      Fused with a human IgG1 Fc tag (Pro 100 - Lys 330; P01857) at the C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab221218 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.61% Tris, 0.75% Glycine, 5% Trehalose, L-Arginine, Sodium chloride

    Lyophilized from 0.22 µm filtered solution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • CD279
    • CD279 antigen
    • hPD 1
    • hPD l
    • hPD-1
    • hSLE1
    • PD 1
    • PD-1
    • PD1
    • PDCD 1
    • PDCD1
    • PDCD1_HUMAN
    • Programmed cell death 1
    • Programmed cell death 1 protein
    • Programmed cell death protein 1
    • Protein PD 1
    • Protein PD-1
    • SLEB2
    • Systemic lupus erythematosus susceptibility 2
    see all
  • Function

    Possible cell death inducer, in association with other factors.
  • Involvement in disease

    Genetic variation in PDCD1 is associated with susceptibility to systemic lupus erythematosus type 2 (SLEB2) [MIM:605218]. Systemic lupus erythematosus is a chronic, inflammatory and often febrile multisystemic disorder of connective tissue. It affects principally the skin, joints, kidneys and serosal membranes. It is thought to represent a failure of the regulatory mechanisms of the autoimmune system.
  • Sequence similarities

    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Developmental stage

    Induced at programmed cell death.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of DTT-reduced ab221218 stained overnight with Coomassie Blue.

    DTT-reduced protein migrates as 50-60 kDa in SDS-PAGE.

References

ab221218 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221218.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up