For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    recombinant-rat-pde1b-protein-ab198476.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Second Messenger Nucleotide Messenger cGMP
Share by email

Recombinant rat PDE1B protein (ab198476)

  • Datasheet
  • SDS
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Functional Studies - Recombinant rat PDE1B protein (ab198476)
  • SDS-PAGE - Recombinant rat PDE1B protein (ab198476)

Key features and details

  • Expression system: Baculovirus infected Sf9 cells
  • Purity: >= 35% SDS-PAGE
  • Active: Yes
  • Tags: His tag N-Terminus, GST tag N-Terminus
  • Suitable for: Functional Studies, SDS-PAGE

Description

  • Product name

    Recombinant rat PDE1B protein
    See all PDE1B proteins and peptides
  • Biological activity

    Specific Activity: ≥ 6800 pmol/min/µg

    Assay Conditions: 10 mM Tris-HCl, pH 7.4, 10 mM MgCl2, 0.1 mg/ml BSA, 0.05% Tween-20, 200 µM cAMP, 2.5 kU 5'-nucleotidase, and serial dilutions of ab198476 at 37°C for 20 min. Quantified by 5'- nucleotidase cleaving the 5' -AMP product and releasing the phosphate group which is detected by Malachite Green Reagent.

  • Purity

    >= 35 % SDS-PAGE.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

    Q01066
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Rat
    • Sequence

      MELSPRSPPEMLESDCPSPLELKSAPSKKMWIKLRSLLRYMVKQLENGEV NIEELKKNLEYTASLLEAVYIDETRQILDTEDELRELRSDAVPSEVRDWL ASTFTQQTRAKGRRAEEKPKFRSIVHAVQAGIFVERMFRRTYTAVGPTYS TAVHNCLKNLDVWCFDVFSLNRAADDHALRTIVFELLTRHSLISRFKIPT VFLMSFLEALETGYGKYKNPYHNQIHAADVTQTVHCFLLRTGMVHCLSEI EVLAIIFAAAIHDYEHTGTTNSFHIQTKSECAILYNDRSVLENHHISSVF RMMQDDEMNIFINLTKDEFVELRALVIEMVLATDMSCHFQQVKTMKTALQ QLERIDKSKALSLLLHAADISHPTKQWSVHSRWTKALMEEFFRQGDKEAE LGLPFSPLCDRTSTLVAQSQIGFIDFIVEPTFSVLTDVAEKSVQPLTDDD SKSKSQPSFQWRQPSLDVDVGDPNPDVVSFRSTWTKYIQENKQKWKERAA SGITNQMSIDELSPCEEEAPSSPAEDEHNQNGNLD
    • Predicted molecular weight

      89 kDa including tags
    • Amino acids

      1 to 535
    • Tags

      His tag N-Terminus , GST tag N-Terminus

Associated products

  • Related Products

    • Anti-6X His tag® antibody [HIS.H8] (ab18184)
    • Anti-6X His tag® antibody [4D11] (ab5000)
    • Anti-6X His tag® antibody (ab9108)

Specifications

Our Abpromise guarantee covers the use of ab198476 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Preservative: 1.36% Imidazole
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.05% DTT, 20% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • 5''-cyclic nucleotide phosphodiesterase 1B
    • 63 kDa Cam PDE
    • 63 kDa Cam-PDE
    • Calcium/calmodulin dependent 3' 5' cyclic nucleotide Phosphodiesterase 1B
    • Calcium/calmodulin stimulated cyclic nucleotide phosphodiesterase
    • Calcium/calmodulin-dependent 3''
    • Calmodulin stimulated phosphodiesterase PDE1B1
    • Cam PDE 1B
    • Cam PDE1B
    • Cam-PDE 1B
    • PDE 1B
    • PDE1B
    • PDE1B_HUMAN
    • PDE1B1
    • PDES 1B
    • PDES1B
    • Phosphodiesterase 1B
    • Phosphodiesterase 1B calmodulin dependent
    • Presumed 63kDa form of the type 1 cyclic nucleotide phosphodiesterase family known as PDE1B
    see all
  • Function

    Cyclic nucleotide phosphodiesterase with a dual-specificity for the second messengers cAMP and cGMP, which are key regulators of many important physiological processes. Has a preference for cGMP as a substrate.
  • Sequence similarities

    Belongs to the cyclic nucleotide phosphodiesterase family. PDE1 subfamily.
  • Cellular localization

    Cytoplasm.
  • Target information above from: UniProt accession Q01064 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • Functional Studies - Recombinant rat PDE1B protein (ab198476)
    Functional Studies - Recombinant rat PDE1B protein (ab198476)

    Example of specific activity of ab198476

  • SDS-PAGE - Recombinant rat PDE1B protein (ab198476)
    SDS-PAGE - Recombinant rat PDE1B protein (ab198476)

    10% SDS-PAGE analysis of ab198476 with Coomassie staining.

    Lane 1: 2.7 μg ab198476
    Lane 2: Protein marker

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

    • Datasheet
    • SDS
  • References (0)

    Publishing research using ab198476? Please let us know so that we can cite the reference in this datasheet.

    ab198476 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab198476.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.