Overview

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Rat
    • Sequence

      MHHHHHHGGGSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKW RNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAE ISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKT YLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDK YLKSSKYIAWPLQGWQATFGGGDHPPKSDPLVPRGSPGEF GQACGHSI LCRSQQYPAARPAEPRGQQVFLKPDEPPPQPCADSLQDALLSL GAVID IAGLRQAAKDALSAVLPKVETVYTYLVDGESRLVCEDPPHELPQEGKIRE AVISRKRLSCDGLGPSDLLGKPLARLVAPLAPDTQVLVIPLLDKETGTVA AVILVHCGQLSDSEEQSLQVVEKHALVALQRVQALQQRRPEAVQNTSADP SEDQKDEKGYTAHDRKILQLCGELYDLDATSLQLKVLRYLQQETQATHCC LLLVSEDNLQLSCKVIGEKVLGEEVSFPLTMGRLGQVVEDKQCIQLKDLT SDDVQQLQNMLGCELRAMLCVPVISRATDQVVALACAFNKLGGDFFTDED ERAIQHCFHYTGTVLTSTLAFQKEQKLKCECQALLQVAKNL FTHLDDV SVLLQEIITEARNLSNAEICSVFLLDQNELVAKVFDGGVVDDESYEIRIP ADQGIAGHVATTGQILNIPDAYAHPLFYRGVDDSTGFRTRNILCFPIKNE NQEVIGVAELVNKINGPWFSKFDEDLATAFSIYCGISIAHSLLYKKVNEA QYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNFANFTYTPRSL PEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMH AFSVSHFCYLLYKNLELSNYLEDIEIFALFISCMCHDLDHRGTNNSFQVA SKSVLAALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQR ML DLMRDIILATDLAHHLRIFKDLQKMAEVGYDRNNKQHHRLLLCLLMTSCD LSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPMEMMDREKAYIPEL QISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIRGLP SNNSLDFLDEEYEVPDLDVTRAPVNGCCSLEG
    • Molecular weight

      133 kDa including tags
    • Amino acids

      18 to 928
    • Tags

      His tag N-Terminus , GST tag N-Terminus
    • Additional sequence information

      His-GST tag and rat PDE2A protein are connected by a linker (PLVPRGSPGEF) including Thrombin Cleavage Site. NM_001143847

Specifications

Our Abpromise guarantee covers the use of ab198484 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Specific Activity: ≥ 2500 pmol/min/µg


    Unit Definition: One unit is defined as the amount of enzyme that will convert 1 pmole of 3', 5'-cAMP to 5'-AMP per minute at 37°C.


    Assay Conditions: 10 mM Tris-HCl, pH 7.4, 10 mM MgCl2, 0.1 mg/ml BSA, 0.05% Tween-20, 200 µM cAMP, 2.5 kU 5'-nucleotidase, and serial dilutions of ab198484 at 37°C for 20 min. Quantified by 5'- nucleotidase cleaving the 5'-AMP product and releasing the phosphate group which is detected by Malachite Green Reagent.

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity

    >= 56 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.05% DTT, 20% Glycerol, 0.12% Glutathione

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • 5''-cyclic phosphodiesterase
    • cGMP dependent 3'5' cyclic phosphodiesterase
    • cGMP stimulated phosphodiesterase 1
    • cGMP stimulated phosphodiesterase 4
    • cGMP-dependent 3''
    • cGMP-stimulated phosphodiesterase 2
    • CGS PDE
    • CGS-PDE
    • cGSPDE
    • Cyclic GMP stimulated phosphodiesterase
    • Cyclic GMP-stimulated phosphodiesterase
    • Human cGMP stimulated 3'5' cyclic nucleotide phosphodiesterase
    • PDE 2A
    • PDE 2A1
    • PDE 2A4
    • PDE2A
    • PDE2A_HUMAN
    • PDE2A1
    • PDE2A4
    • phosphodiesterase 2A
    • Phosphodiesterase 2A cGMP stimulated
    see all
  • Function

    Cyclic nucleotide phosphodiesterase with a dual-specificity for the second messengers cAMP and cGMP, which are key regulators of many important physiological processes.
  • Tissue specificity

    Expressed in brain and to a lesser extent in heart, placenta, lung, skeletal muscle, kidney and pancreas.
  • Sequence similarities

    Belongs to the cyclic nucleotide phosphodiesterase family. PDE2 subfamily.
    Contains 2 GAF domains.
  • Domain

    GAF 1 functions as a dimerization domain, whereas GAF 2 binds cGMP, which causes activation of the catalytic activity of the enzyme.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • Example of specific activity of ab198484

  • 10% SDS PAGE analysis of ab198484 (5 μg).

References

ab198484 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198484.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up